KEGG   Oryctolagus cuniculus (rabbit): 100008606
Entry
100008606         CDS       T03373                                 

Definition
(RefSeq) interferon-induced GTP-binding protein Mx2
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05160  Hepatitis C
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100008606
   05164 Influenza A
    100008606
   05160 Hepatitis C
    100008606
   05165 Human papillomavirus infection
    100008606
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 AAA_16 ABC_tran AAA_29 AAA_15
Other DBs
NCBI-GeneID: 100008606
NCBI-ProteinID: XP_017196110
Ensembl: ENSOCUG00000004501
LinkDB
Position
Un
AA seq 704 aa
MSRAHRNRLQKQKSFSSRFCLKEEMSFSLQKSPPCVVGPKEWPAPPEWLAGRADPTSLPK
DFNFLSLVEQQASKAKGPENNLYAQYEERVRPCIDLIDSLRALGVEQDLALPAIAVIGDQ
SSGKSSVLEALSGVALPRGSGIVTRCPLVLRLKKLPAEAEWRGRVSYQDQEVELCDPAQV
EPAVTKAQNVIAGEGLGISSELISLEVSSPLVPDLTLIDLPGITRVAVGGQPADIGHQIK
ALIRKYIQRQETINLVVVPSNVDIATTEALSMAQEVDPDGDRTIGILTKPDLVDRGTEDK
VVDVARNLVFHLKKGYTVVKCRGQQDIQERLSLEQALQRERAFFQEHPHFRVLLEEGRAT
VPSLAERLSTELIEHICKTLPLLEKQIKQNHEQCTEELQKFGVDIPEDDSDRLLFLIDKI
NAFNQDITALIQGEEVVRENETRLFTKLRAEFCKWESVIEKNFKAGSSNIRNQLWKFENQ
YRGRELPGFVNFKTFETIVKQHIRALELPAQDMLHRVTDMVRAAFTDVSERNFHEFFNLH
KTTKSKIEDIRLEQEKEAEREIRLHFRVEQVVYCQDQVYRGALKKVREAEAEEEKKSQRF
RGSSSGLGSSQDSCSLAEIIEHLVAYYQETGSRLSSLVPMLVQFFVLQSYGQELQKSMLQ
LLHNKENCGWLLRERSDTSTKRRFLKERLARLAQARRRLAKFPG
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgtccagagcacacaggaaccggctgcagaagcaaaagtcgttttcctcccgtttctgc
ctcaaagaagaaatgagcttctcactgcaaaagtccccgccgtgtgtcgtggggccgaag
gaatggccggcaccccccgaatggctggcgggaagggcggaccccacttcgctccccaag
gacttcaactttctgagcctggtcgagcagcaggcctcgaaggccaaggggcctgagaac
aacctgtacgcccagtacgaggagagggtgcgcccgtgcatcgacctcatcgactccctg
cgggccctgggcgtggagcaggacctggcgctgcccgccatcgccgtcatcggggaccag
agctcgggcaagagctccgtgctggaggccctgtcgggtgtggccctccccaggggcagc
ggcattgtcacgcggtgccctctggtgctgaggctgaagaagctgcccgcggaagccgag
tggaggggccgggtcagctaccaggaccaggaggtggagctctgcgaccccgcgcaggtg
gagcccgcagtgactaaagcccagaacgtgatcgccggggaggggctgggcatcagctcc
gagctcatcagcctggaggtcagctccccgctcgtgccggacctgaccctcatcgacctg
cccggcatcaccagggtggccgtgggcggccagcccgcggacatcgggcaccagatcaag
gcgctcatcaggaaatacatccagaggcaggagaccatcaacctggtcgtggtccccagc
aacgtggacatcgccaccaccgaggcgctgagcatggcccaggaggtggaccccgatggg
gacaggaccattggcatcctgacgaagcctgacctggtggacaggggcacggaggacaag
gtggtggacgtggcgcggaacctcgtgttccacctgaagaagggctacacggtggtgaag
tgccgcgggcagcaggacatccaggagcggctgagcctggagcaggccctgcagagggag
cgggccttcttccaggagcacccccacttcagggttcttctggaggagggcagggccacg
gtgcccagcctggccgagagactgagcaccgagctgatcgaacacatctgtaaaacgctg
cccctgttggagaagcagatcaagcagaaccacgagcagtgcacggaggagctgcagaag
ttcggcgtggacatccccgaggacgacagcgacaggctgctcttcctgattgacaaaatc
aacgcatttaatcaggacatcactgccctcattcaaggggaggaggtcgtccgggagaac
gaaacccggctgttcaccaagctgagggccgagttctgcaaatgggagagcgtgatcgag
aagaatttcaaggcaggttctagtaacatccggaaccaactgtggaagtttgaaaaccag
taccgtggccgagagctgccgggatttgtgaactttaagacgtttgagacgattgtgaaa
cagcacatcagagccctagagttgccggctcaggacatgctgcacagggtgacagacatg
gtgcgcgccgccttcacagatgtgtcagagagaaacttccatgagttcttcaacctgcac
aagaccaccaagtccaaaatcgaggacatccgcctggaacaggagaaggaggccgagcgc
gagatccggctgcacttccgggtggagcaggtcgtctactgccaggaccaggtgtaccgg
ggcgcgctgaagaaggtccgggaggcggaggccgaggaggagaagaagtctcagaggttc
cgcggctcctcctccggactcggctcctcccaggactcctgctccttggccgaaatcatc
gagcacctggtggcctactaccaggagacgggcagccgcctgtccagcctggtcccgatg
ctcgtgcagttcttcgtgctgcagtcctacgggcaggagctgcagaagtccatgctgcag
ctgctgcacaacaaggagaactgcggctggctgctgagagagcgcagcgacaccagcacc
aagaggaggttcctgaaggagcggctggcgcggctggcccaggcccggcgccggctcgcc
aagttcccgggctga

KEGG   Oryctolagus cuniculus (rabbit): 100009451
Entry
100009451         CDS       T03373                                 

Gene name
MX2
Definition
(RefSeq) interferon-induced GTP-binding protein Mx2
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05160  Hepatitis C
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100009451 (MX2)
   05164 Influenza A
    100009451 (MX2)
   05160 Hepatitis C
    100009451 (MX2)
   05165 Human papillomavirus infection
    100009451 (MX2)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_15 AAA_16 AAA_21 ABC_tran AAA_29
Other DBs
NCBI-GeneID: 100009451
NCBI-ProteinID: XP_008250692
Ensembl: ENSOCUG00000021037
LinkDB
Position
Un
AA seq 709 aa
MSRAHRNRLQKQKSFSSRFCLKEEMSFSLQKSPPCVVGPKEWPAPPEWLAGRADPTSLPK
DFNFLSLVEQQASKAKGPENNLYAQYEERVRPCIDLIDSLRALGVEQDLALPAIAVIGDQ
SSGKSSVLEALSGVPLPRGNGIITRCPLELKMKKQPWASRWRATVSYRDVRLQLDSPSQV
EKEIRKAQKALTGSDTSISQELITLEVTSCEVPDLTLIDLPGIARLAIGGQPRDIGEQIK
ALIRKYIQRQETINLVVVPSNVDIATTEALSMAREVDPDGDRTIGVLTKPDLVDRGTEKG
VLQVAQNLTYHLKKGYMMVRCRAQQEVLNNLSCAEAAKREMQFFEVHPHFRVLLDNGMAT
VPRLAERLTEELSEHISKSLPLLETQIREKHLQATEELRSCGADVPSQEADMMFFLIEKI
KLFNQDIEKLVEAEEAVKEKETRMYNRVRQQFQRWAGVLTASNLRVKNNIQDEISKYENQ
YRGKELLGFVSYKTFETIVQQHLQQLVDPALQVLLSAVEIVQQAFCDTAAKHFSDFSNLH
QIVRNNIEGIRTRQVEKAQEVIQLQFKMEKLVYCQDQIYSTVLKGVRQEALQPPGNTPLA
FPLASRSAKDTAQVSTVSEIGAHVEAYCLETSKRLSNQIPFIIQFFILRENGDCLQKAML
RTLQEKERYSWLLQEHKETATKRKALKERLFRLAQARRTLWQFSKGGVH
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgtccagagcacacaggaaccggctgcagaagcaaaagtcgttttcctcccgtttctgc
ctcaaagaagaaatgagcttctcactgcaaaagtccccgccgtgtgtcgtggggccgaag
gaatggccggcaccccccgaatggctggcgggaagggcggaccccacttcgctccccaag
gacttcaactttctgagcctggtcgagcagcaggcctcgaaggccaaggggcctgagaac
aacctgtacgcccagtacgaggagagggtgcgcccgtgcatcgacctcatcgactccctg
cgggccctgggcgtggagcaggacctggcgctgcccgccatcgccgtcatcggggaccag
agctcgggcaagagctccgtgctggaggccctctctggagtccccctccccagaggcaac
gggatcatcacgaggtgcccgctggagctgaagatgaagaagcagccgtgggcgtccagg
tggagggcaaccgtcagctaccgggacgtgcggctgcagctggacagcccctcccaggtg
gagaaggagatccggaaagcccagaaagccctgacgggaagtgacacgagcatcagtcag
gagctcatcaccctggaggtcacctcctgcgaggttcccgacctcacgctcattgacctg
cctggcattgccaggctggctataggcgggcagccccgggacatcggagagcagatcaag
gcgctcatcaggaaatacatccagaggcaggagaccatcaacctggtcgtggtccccagc
aacgtggacatcgccaccaccgaggcgctgagcatggcccgggaggtggaccccgacggg
gacaggaccatcggggtgctgaccaagcccgacctggtggacaggggcaccgagaagggc
gtgctgcaggtggcgcagaacctcacctaccacctcaagaagggctacatgatggtgagg
tgccgggcccagcaggaggtcctcaacaacctgagctgcgccgaggcggccaagagagag
atgcagttctttgaggtgcacccgcacttcagagttctcctggacaatgggatggccacg
gtgccccggctggcggaaaggctaacggaggagctcagcgaacacatcagtaaatcactc
ccactgttggagactcagatacgagagaagcacctgcaggcgaccgaggagctgcggagc
tgtggggccgacgtccccagccaggaggccgacatgatgttctttctgattgagaaaatc
aagctgtttaaccaggacatcgagaagctggtggaggcggaggaagccgtgaaggagaag
gagacgcgcatgtacaacagggtgcgccagcagttccagcgctgggccggcgtcctcact
gccagcaacctgagagtgaaaaataacattcaggacgaaatctcaaagtacgagaatcag
tatcgcggcaaggagcttctgggcttcgtcagctacaagacgttcgagaccatcgtccag
cagcacctgcagcagctggtggaccccgcgctccaagtgctgctcagcgccgtggagatc
gtccagcaagctttctgcgacacggccgcgaagcacttcagcgatttttccaacctccat
cagatcgtccggaacaacatcgaaggcatcagaacgaggcaggtggagaaggcgcaggag
gtgatccagctgcagttcaagatggagaagctggtctactgccaggaccagatctacagc
acagtgctcaagggtgtccgccaggaggcgctgcagcccccggggaacacgcccctggcc
ttccccctggcctcccgctctgccaaagacacagcccaagtctccaccgtcagcgaaatc
ggagcccacgtggaggcgtactgcttggaaaccagcaaacggctgtccaaccagatcccg
ttcataattcagtttttcatacttcgagaaaacggcgactgcctgcagaaagccatgctg
aggaccctccaggagaaagagaggtactcctggctgctgcaggagcacaaggagaccgcc
accaagcgcaaggccctgaaggagcggctcttccggctggcccaggcgcggcgcacgctc
tggcagttctccaagggaggggtgcactga

KEGG   Oryctolagus cuniculus (rabbit): 100359014
Entry
100359014         CDS       T03373                                 

Gene name
MX1
Definition
(RefSeq) MX dynamin like GTPase 1
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05160  Hepatitis C
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100359014 (MX1)
   05164 Influenza A
    100359014 (MX1)
   05160 Hepatitis C
    100359014 (MX1)
   05165 Human papillomavirus infection
    100359014 (MX1)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 AAA_16 AAA_29 ABC_tran AAA_15
Other DBs
NCBI-GeneID: 100359014
NCBI-ProteinID: XP_002723805
Ensembl: ENSOCUG00000021924
LinkDB
Position
Un
AA seq 663 aa
MVQSGVESRSPDSAAEPSAATLNGDAHPAESAQPRGPENNLYAQYEERVRPCIDLIDSLR
ALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLRLKKLPPEAEW
RGWVSYQDQEVELCDPAQVEPAVTKAQNVIAGEGLGISSELISLEVSSPLVPDLTLIDLP
GITRVAVGGQPADIGHQIKALIRKYIRRQETINLVVVPSNVDIATTEALSMAQEVDPDGD
RTIGILTKPDLVDRGTEDKVVDVARNLVFHLKKGYTVVKCRGQQDIQERLSLEQALQRER
AFFQEHPHFRVLLEEGRATVPSLAERLSTELIEHICKTLPLLEKQIKQNHEQCTEELQKF
GVDIPEDDSDRLLFLIDKINAFNQDITALIQGEEVVRENETRLFTKLRAEFCKWESVIEK
NFKAGSSNIRNQLWKFENQYRGRELPGFVNFKTFETIVKQHIRALELPAQDMLHRVTDMV
RAAFTDVSERNFHEFFNLHKTTKSKIEDIRLEQEKEAEREIRLHFRVEQVVYCQDQVYRG
ALKKVREAEAEEEKKSQRFGGSSSGLGSSQDSCSLAEIIEHLVAYYQETGSRLSSLVPML
VQFFVLQSYGQELQKSMLQLLHNKENCGWLLRERSDTSTKRRFLKERLARLAQARRRLAK
FPG
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggtgcagtctggggtggaatccaggagtccggattcagccgctgagcccagtgcagcg
acactgaatggagacgctcacccggcagagagcgcgcagcccagggggcctgagaacaac
ctgtacgcccagtacgaggagagggtgcgcccgtgcatcgacctcatcgactccctgagg
gccctgggcgtggagcaggacctggcgctgcccgccatcgccgtcatcggggaccagagc
tcgggcaagagctccgtgctggaggccctgtcgggcgtggccctccccaggggcagcggc
attgtcacgcggtgccctctggtgctgaggctgaagaagctgcccccggaagccgagtgg
aggggctgggtcagctaccaggaccaggaggtggagctctgcgaccccgcgcaggtggag
cccgcagtgactaaagcccagaacgtgatcgccggggaggggctgggcatcagctccgag
ctcatcagcctggaggtcagctccccgctcgtgccggacctgaccctcatcgacctgccc
ggcatcaccagggtggccgtgggcggccagcccgcggacatcgggcaccagatcaaggcg
ctcatcaggaaatacatccggaggcaggagaccatcaacctggtcgtggtccccagcaac
gtggacatcgccaccaccgaggccctgagcatggcccaggaggtggaccccgacggggac
aggaccatcggcatcctgacgaagcctgacctggtggacaggggcacggaggacaaggtg
gtggacgtggcgcggaacctcgtgttccacctgaagaagggctacacggtggtgaagtgc
cgcgggcagcaggacatccaggagcggctgagcctggagcaggccctgcagagggagcgg
gccttcttccaggagcacccccacttcagggttcttctggaggagggcagggccacggtg
cccagcctggccgagagactgagcaccgagctgattgaacacatctgtaaaacgctgccc
ctgttggagaagcagatcaagcagaaccacgagcagtgcacggaggagctgcagaagttc
ggcgtggacatccccgaggacgacagcgacaggctgctcttcctgattgacaaaatcaac
gcatttaatcaggacatcactgccctcattcaaggggaggaggtcgtccgggagaacgaa
acccggctgttcaccaagctgagggccgagttctgcaaatgggagagcgtgatcgagaag
aatttcaaggcaggttctagtaacatccggaaccaactgtggaagtttgaaaaccagtac
cgtggccgagagctgccgggatttgtgaactttaagacgtttgagacgattgtgaaacag
cacatcagagccctagagttgccggctcaggacatgctgcacagggtgacagacatggtg
cgcgccgccttcacagatgtgtcagagagaaacttccatgagttcttcaacctgcacaag
accaccaagtccaaaatcgaggacatccgcctggaacaggagaaggaggccgagcgcgag
atccggctgcacttccgggtggagcaggtcgtctactgccaggaccaggtgtaccggggc
gcgctgaagaaggtccgggaggcggaggccgaggaggagaagaagtctcagaggttcggc
ggctcctcctccggactcggctcctcccaggactcctgctccttggccgaaatcatcgag
cacctggtggcctactaccaggagacgggcagccgcctgtccagcctcgtcccgatgctc
gtgcagttcttcgtgctgcagtcctacgggcaggagctgcagaagtccatgctgcagctg
ctgcacaacaaggagaactgcggctggctgctgagagagcgcagcgacaccagcaccaag
aggaggttcctgaaggagcggctggcgcggctggcccaggcccggcgccggctcgccaag
ttcccgggctga

DBGET integrated database retrieval system