KEGG   Oryctolagus cuniculus (rabbit): 100008618
Entry
100008618         CDS       T03373                                 

Gene name
GSPT1, ELF
Definition
(RefSeq) G1 to S phase transition 1
  KO
K03267  peptide chain release factor subunit 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100008618 (GSPT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100008618 (GSPT1)
   03012 Translation factors [BR:ocu03012]
    100008618 (GSPT1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     100008618 (GSPT1)
Translation factors [BR:ocu03012]
 Eukaryotic type
  Release factors
   100008618 (GSPT1)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 PAM2 MMR_HSR1
Other DBs
NCBI-GeneID: 100008618
NCBI-ProteinID: XP_002711802
Ensembl: ENSOCUG00000004759
UniProt: A0A5F9CY66
LinkDB
Position
6
AA seq 638 aa
MDPGSGGGGGGGGGGGSSSSSDSAPDCWDQADMEAPGPGPCGGSGGSLAAAAAAEAQRDH
LSAAFSRQLNVNAKPFVPNVHAAEFVPSFLRGPAPPPPAPAGAAGNNHGAGSVAGGPSAP
VESSQEEQSLCEGSVSAVSMELSEPVVENGETEMSPEESWEHKEEISEAEPGGGSLGDGR
PPEEGAQEMMEEEEEMPKPKSVAAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMV
DKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPG
HKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINK
MDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIG
LPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNV
EVLGILSDDVETDSVAPGENLKIRLKGIEEEEILPGFILCDLNNLCHSGRTFDAQIVIIE
HKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAG
TICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggatccgggcagcggcggcggcggcggtggcggcggcggcggcgggagcagcagcagc
agcgactcggcgcccgactgctgggatcaggcggacatggaagcccccgggcccggcccg
tgcggcggcagcggcgggtccctggcggcggcggcggcggccgaggcccagcgtgaccac
ctcagcgcggccttcagccggcagctcaacgtcaacgccaaacctttcgtgcccaacgtc
cacgccgcggagttcgtaccgtctttcctgcggggcccggccccgccgccgccagccccg
gctggcgccgccggcaacaaccacggagcgggcagcgtcgcgggaggcccttcggcacct
gtggaatcctctcaagaggaacagtcattgtgtgaaggctccgtttcagctgttagcatg
gaactttcagaacctgttgtagagaacggagagacagaaatgtccccagaagaatcatgg
gagcacaaagaagaaataagtgaggcagagccagggggtggctccctgggagatggaagg
ccaccggaggaaggtgcccaagaaatgatggaggaggaagaggaaatgccaaagcccaaa
tctgtagctgcgcctcctggtgcccctaaaaaagaacatgtaaatgtagtgtttattggg
catgtagatgctggcaagtcaaccattggaggccaaataatgtatttgactggaatggtt
gataaaaggacacttgagaaatatgaaagagaagctaaagaaaaaaacagagaaacttgg
tacttgtcttgggccctagatacaaatcaggaagaacgagacaaaggtaaaacagtcgaa
gtgggtcgtgcctactttgaaacagaaaagaagcatttcacaattctagacgcccctggc
cacaagagttttgtcccaaatatgattggtggcgcctctcaagctgatttggctgtgctg
gtcatctctgccaggaaaggagagtttgaaactggatttgaaaaaggaggacagacaaga
gaacacgcaatgttggcaaagacagcaggtgtaaagcacttaattgtgcttattaataag
atggatgacccaacagtgaattggagcaacgagagatatgaagaatgtaaagagaaacta
gtgccatttttgaaaaaagttggcttcaatcccaaaaaggacattcactttatgccctgc
tcaggactgactggagcaaatctcaaagagcaatcagatttctgtccttggtacattgga
ttaccatttattccatatctggataatttgccaaacttcaatagatcagttgatggacca
atcagactgccgattgtggataagtacaaggatatgggcactgtggtcctgggaaagctg
gaatcgggatctatttgtaaaggccagcagctagtgatgatgccgaacaagcacaacgtg
gaagttcttggaatactttctgatgatgtagaaactgattctgtagccccaggtgagaac
ctgaaaatcagactcaaaggaattgaggaagaagagattcttccaggattcatcctttgt
gatcttaataatctttgccattctggacgcacatttgatgcccagatagtgattatagag
cacaaatccatcatctgcccagggtacaatgcggtgctgcatattcatacctgtattgag
gaagtcgagataacagccttaatctgcttggtagacaaaaagtcaggagagaaaagcaag
actcggccccgttttgtgaaacaagatcaagtgtgcattgcccgtcttcggacagcagga
accatctgccttgagacctttaaggacttccctcagatgggtcgttttaccttaagagat
gagggtaagaccattgcaattggaaaagttctgaaactggttccagaaaaagactaa

KEGG   Oryctolagus cuniculus (rabbit): 100355660
Entry
100355660         CDS       T03373                                 

Gene name
GSPT2
Definition
(RefSeq) G1 to S phase transition 2
  KO
K03267  peptide chain release factor subunit 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100355660 (GSPT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100355660 (GSPT2)
   03012 Translation factors [BR:ocu03012]
    100355660 (GSPT2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     100355660 (GSPT2)
Translation factors [BR:ocu03012]
 Eukaryotic type
  Release factors
   100355660 (GSPT2)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 PAM2 MMR_HSR1 G-alpha
Other DBs
NCBI-GeneID: 100355660
NCBI-ProteinID: XP_002721695
UniProt: A0A5F9C3E4
LinkDB
Position
Un
AA seq 629 aa
MDPGSSSSSDSAPECWDQVDMDTPGLAPSGDGAASSAVAEAQREHLSSAFSRQLNVNAKP
FVPNVHAAEFVPSFLRGSAQPPTPAAGLGSMDETCTSAGDPAAGKRLGRGAPVEPPKELL
VCEGSNSAVTMELSEPLIENGEVEMILEESWEHSKEVSEAEPGGCVLGDSGPPEESGQEM
MEEKEETRKSKSSVVPSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYE
REAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMI
GGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLVVLINKMDDPTVNWS
CERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTGANIKDQSELCPWYTGLPFIPYLDN
LPNFNRSIDGPIRLPIVDKYKDMGTVVLGKLESGSIYKGQQLVMMPNKHNVEVLGILSDD
TETDFVAPGENLKIRLKGIEEEEILPGFILCDPSNLCHSGRTFDVQIVIIEHKSIICPGY
NAVLHIHTCIEEVEITALISLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKD
FPQMGRFTLRDEGKTIAIGKVLKLVPEKD
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggatcccggcagcagcagcagcagcgactcggcgcccgagtgctgggaccaggtggac
atggacaccccgggtttggccccgagtggggacggagccgcctcctcggcagtggccgag
gcccagcgcgagcatctcagctcggcctttagccgtcagctcaacgtcaacgccaaaccc
ttcgtgcctaacgtacacgccgcggagttcgtgccgtccttcctgcggggctcggcccag
ccgcccacccccgccgccggcttgggcagcatggatgagacctgcaccagcgcgggagac
cctgctgcaggtaaaaggctgggacggggggcacctgtggaacctcccaaagaactgtta
gtgtgtgaaggttccaattcagccgttaccatggaactttcagaacctcttatagaaaat
ggagaggtggaaatgatcttagaagaatcatgggagcacagtaaagaagtaagtgaagca
gagcctgggggttgtgtcttgggcgattcggggcccccagaagaaagtggccaggagatg
atggaggagaaagaggagaccagaaaatccaaatcctctgtcgtaccctcaggtgctccc
aaaaaagaacacgtaaatgtggtgttcattgggcatgtggatgccggcaagtccaccatt
ggagggcagataatgtttttaactggaatggttgacaaaaggacacttgagaaatacgaa
cgagaagctaaggaaaaaaacagagaaacttggtatttgtcctgggcgttagataccaac
caggaagaacgagacaagggaaaaaccgtagaagtgggtcgtgcctattttgaaactgaa
aagaaacatttcacgattttagatgcccctggccataagagttttgtcccaaatatgatt
ggtggtgcctctcaagctgatctggctgtgctggtcatctctgccaggaagggagagttt
gagactggatttgaaaaaggtggacagacgagagaacatgcgatgttggccaaaacagca
ggggtaaaacatttggttgtgcttattaataagatggatgaccccacggtgaattggagc
tgtgagaggtatgaagaatgtaaagaaaaactggtgccgtttttgaaaaaagtcggcttc
agtcccaaaaaggacattcacttcatgccctgctcaggactgactggggctaacattaaa
gaccagtcagagctctgcccctggtacactggattaccattcattccgtatttggataat
ttgccaaacttcaacaggtcgattgatgggccaatcaggctcccaattgttgacaagtac
aaggatatgggtactgtggtcctgggcaagctggaatcgggatccatttataaaggccaa
cagctcgtgatgatgccaaataaacacaatgtggaagttcttggaattctttctgacgat
actgagactgattttgtggccccaggtgaaaacctcaaaatcaggctgaaggggattgaa
gaagaagagattcttcccggattcatcctttgtgaccctagcaatctttgccattccgga
cgcacattcgatgtccagatagtgattattgagcacaaatccatcatctgtccaggttat
aatgcggtgctgcacatccacacttgcattgaggaagttgagataacagccttaatctcc
ctcgtcgacaaaaagtcaggagaaaaaagtaagacacggccccgcttcgtgaagcaagat
caagtgtgcattgcccgattaaggacagccgggactatctgccttgagacttttaaagac
tttcctcagatgggccgcttcactttgagagatgagggtaagaccattgcaattggaaaa
gttctgaaactggttccagagaaggactaa

DBGET integrated database retrieval system