KEGG   Oryctolagus cuniculus (rabbit): 100008660Help
Entry
100008660         CDS       T03373                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00500  Starch and sucrose metabolism
ocu01100  Metabolic pathways
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04910  Insulin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04931  Insulin resistance
Module
ocu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100008660 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100008660 (GYS1)
   04152 AMPK signaling pathway
    100008660 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100008660 (GYS1)
   04922 Glucagon signaling pathway
    100008660 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    100008660 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ocu01003]
    100008660 (GYS1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100008660 (GYS1)
Glycosyltransferases [BR:ocu01003]
 Polysaccharide
  Storage polysaccharide
   100008660 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 100008660
NCBI-ProteinID: NP_001075492
Ensembl: ENSOCUG00000000015
UniProt: P13834
LinkDB All DBs
Position
Un
AA seq 735 aa AA seqDB search
MPLSRTLSVSSLPGLEDWEDEFDLENSVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYFLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPDHFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGLPEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSSGGSKRSNSVDTSSLSTP
SEPLSPASSLGEERN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaagccgcaccttgtccgtgtcctcgctgccgggactggaggattgggaggat
gagttcgacttggagaactcggtactcttcgaagtggcctgggaggtggccaacaaggtg
ggcggcatctacacggtgctgcagaccaaggccaaggtgacgggagacgaatggggcgac
aactacttcctggtgggaccctacaccgagcaaggcgtgaggacccaggtggagctgctg
gagcccccgacccctgccctgaagaggaccctggactccatgaacagcaagggttgcaag
gtgtacttcgggcgctggctgatcgaggggggccctctggtggtgctgttggacgtgggg
gcctccgcctgggccctggagcgctggaagggagagctctgggacacctgcaacatcggg
gtgccctggtacgaccgcgaggccaacgacgctgtcctctttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagaatgaggagaagccgcacgtggtcgcacacttccac
gagtggctggcgggcatcgggctttgcctgtgccgagcccggcggctgcccgtggcgacc
atcttcaccacccatgccacactgctggggcgttacctgtgtgccggcgctgtggacttc
tacaacaacttggagaactttaacgtggacaaggaagccggtgagaggcagatataccac
cgctactgcatggagcgggcagcggcccactgcgcccacgtcttcactaccgtgtcacag
atcaccgccatcgaggcccagcacctgctcaagaggaagccagacattgtgacccccaac
ggcctgaatgtgaagaagttctctgccatgcacgagttccagaacctccatgcccagagc
aaggctcggatccaggagtttgtgcggggtcacttttatggacacctagacttcaacttg
gacaagaccttgtacttctttatcgctggccgctacgagttctccaacaagggggccgac
gtcttcctggaggccttggctcggctcaactacctgctcagagtgaacggcagcgagcag
acggtggtcgccttcttcatcatgccggctcggaccaacaatttcaacgtggagacactg
aagggccaggccgtgcgcaaacagctttgggacacagccaacacggtgaaggagaagttc
gggaggaagctgtatgaatccttgctggtggggagcctcccggacatgaacaagatgctg
gacaaggaagacttcaccatgatgaagagggccatctttgccacgcagcggcagtctttc
ccccccgtgtgcacccacaacatgctggacgactcctcggaccccatcctcaccaccatc
cgccgaatcggcctcttcaacagcagtgccgacagggtgaaggtgattttccacccagag
ttcctgtcctccacaagccccctgctccctgtggactacgaggagttcgtccgtggctgc
cacctgggggtcttcccctcctactacgagccttggggctacacaccagccgagtgcacg
gtgatgggcatccccagcatctccaccaacctctcgggcttcggctgcttcatggaggaa
cacatcgcagacccctcggcctacggcatctacatcctggaccggcgcttccgcagcctg
gacgactcctgctcgcagctcacctccttcctctacagcttctgccagcagagccgcagg
cagcgcatcatccagcggaaccgcaccgagcgcctctccgacctcctggactggaagtac
ctgggccggtactacatgtctgctcgccacatggccctggccaaggcctttccggatcac
ttcacctacgagccacacgaggcggatgcgacccagggctaccgctacccgcggcccgcc
tctgtgccaccgtcgccctcgctgtcgcggcactcgagcccacaccagagcgaggacgag
gaggagccccgggacggcctccccgaggaagacggagagcgttacgacgaggatgaggag
gccgccaaggaccggcgcaacatccgcgccccggagtggccgcgccgggcctcctgcacc
tcgtccagcggcgggagcaagcgcagcaactcggtggacaccagctcgctcagcaccccc
agcgagcccctgagccccgccagctccctgggcgaggagcgcaactga

DBGET integrated database retrieval system