KEGG   Oryctolagus cuniculus (rabbit): 100008668
Entry
100008668         CDS       T03373                                 

Gene name
IGF1, IGF-IB
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04114  Oocyte meiosis
ocu04115  p53 signaling pathway
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04510  Focal adhesion
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04730  Long-term depression
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04935  Growth hormone synthesis, secretion and action
ocu04960  Aldosterone-regulated sodium reabsorption
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05205  Proteoglycans in cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05224  Breast cancer
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008668 (IGF1)
   04014 Ras signaling pathway
    100008668 (IGF1)
   04015 Rap1 signaling pathway
    100008668 (IGF1)
   04066 HIF-1 signaling pathway
    100008668 (IGF1)
   04068 FoxO signaling pathway
    100008668 (IGF1)
   04151 PI3K-Akt signaling pathway
    100008668 (IGF1)
   04152 AMPK signaling pathway
    100008668 (IGF1)
   04150 mTOR signaling pathway
    100008668 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100008668 (IGF1)
   04115 p53 signaling pathway
    100008668 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100008668 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100008668 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100008668 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    100008668 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    100008668 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100008668 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    100008668 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100008668 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    100008668 (IGF1)
   04213 Longevity regulating pathway - multiple species
    100008668 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008668 (IGF1)
   05202 Transcriptional misregulation in cancer
    100008668 (IGF1)
   05205 Proteoglycans in cancer
    100008668 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    100008668 (IGF1)
   05218 Melanoma
    100008668 (IGF1)
   05215 Prostate cancer
    100008668 (IGF1)
   05224 Breast cancer
    100008668 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100008668 (IGF1)
   05414 Dilated cardiomyopathy
    100008668 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100008668 (IGF1)
   01522 Endocrine resistance
    100008668 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008668 (IGF1)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   100008668 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 100008668
NCBI-ProteinID: NP_001075495
Ensembl: ENSOCUG00000014689
UniProt: Q95222
LinkDB
Position
4
AA seq 143 aa
MITPTVKMRILSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKP
TGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKAARSVRAQRHTDMPKTQKYQ
PPSTNKKMKSQRRRKGSTFEEHK
NT seq 432 nt   +upstreamnt  +downstreamnt
atgattacacctacagtaaagatgcgcatcctgtcctcctcgcatctcttctacctggcc
ctctgcttgctcaccttcaccagctcggccacagccggaccggagacgctctgcggtgct
gagctggtggatgctcttcagttcgtgtgtggagacaggggcttttatttcaacaagccc
acaggatacggctccagcagtcggagggcacctcagacaggcatcgtggatgagtgctgc
ttccggagctgtgatctgaggaggctggagatgtactgtgcacccctcaagccggcaaag
gcagcccgctccgtccgtgcccagcgccacaccgacatgcccaagactcagaagtatcag
cctccatctaccaacaagaaaatgaagtctcagaggagaaggaaaggaagtacatttgaa
gaacacaagtag

DBGET integrated database retrieval system