KEGG   Oryctolagus cuniculus (rabbit): 100008733
Entry
100008733         CDS       T03373                                 

Gene name
IL6, IL-6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01523  Antifolate resistance
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04218  Cellular senescence
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04657  IL-17 signaling pathway
ocu04659  Th17 cell differentiation
ocu04668  TNF signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05010  Alzheimer disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05332  Graft-versus-host disease
ocu05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100008733 (IL6)
   04668 TNF signaling pathway
    100008733 (IL6)
   04066 HIF-1 signaling pathway
    100008733 (IL6)
   04068 FoxO signaling pathway
    100008733 (IL6)
   04151 PI3K-Akt signaling pathway
    100008733 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008733 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100008733 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100008733 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100008733 (IL6)
   04620 Toll-like receptor signaling pathway
    100008733 (IL6)
   04621 NOD-like receptor signaling pathway
    100008733 (IL6)
   04623 Cytosolic DNA-sensing pathway
    100008733 (IL6)
   04625 C-type lectin receptor signaling pathway
    100008733 (IL6)
   04659 Th17 cell differentiation
    100008733 (IL6)
   04657 IL-17 signaling pathway
    100008733 (IL6)
   04672 Intestinal immune network for IgA production
    100008733 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008733 (IL6)
   05202 Transcriptional misregulation in cancer
    100008733 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100008733 (IL6)
   05321 Inflammatory bowel disease
    100008733 (IL6)
   05332 Graft-versus-host disease
    100008733 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100008733 (IL6)
   05020 Prion disease
    100008733 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    100008733 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100008733 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100008733 (IL6)
   04931 Insulin resistance
    100008733 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100008733 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100008733 (IL6)
   05135 Yersinia infection
    100008733 (IL6)
   05133 Pertussis
    100008733 (IL6)
   05134 Legionellosis
    100008733 (IL6)
   05152 Tuberculosis
    100008733 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100008733 (IL6)
   05162 Measles
    100008733 (IL6)
   05164 Influenza A
    100008733 (IL6)
   05161 Hepatitis B
    100008733 (IL6)
   05168 Herpes simplex virus 1 infection
    100008733 (IL6)
   05163 Human cytomegalovirus infection
    100008733 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100008733 (IL6)
   05169 Epstein-Barr virus infection
    100008733 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100008733 (IL6)
   05144 Malaria
    100008733 (IL6)
   05142 Chagas disease
    100008733 (IL6)
   05143 African trypanosomiasis
    100008733 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100008733 (IL6)
   01523 Antifolate resistance
    100008733 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008733 (IL6)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100008733 (IL6)
SSDB
Motif
Pfam: IL6 DUF641 IL11 IL23 UPF0147 FliJ Telomere_reg-2
Other DBs
NCBI-GeneID: 100008733
NCBI-ProteinID: NP_001075533
Ensembl: ENSOCUG00000027471
UniProt: Q9MZR1
LinkDB
Position
10
AA seq 241 aa
MNSFTSALRPGPLGCSLALLLVVATAFPTSAPVREDSNTKASPDKTLTPPGRTIESIRSI
LETIKELRKEMCDHDVNCMNRKEALAEVNLHLPRLIEEDGCFPPAVNNETCLLRITSGLM
EFRMYLEHLQAKFRSDEENTRVSMVLKNIQHLIKTLRPKVKNLNEEATLKPAVAVSLMEN
LQQKNQWLKTTTIHFILRGLTNFLEFTLRAVDLMECGCPCLRNFMGSASHGQNTPSCPLD
T
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaactccttcacaagcgccctccgcccaggtcccctcggctgctcgctggcgctgctc
ctggtggtggctaccgctttccccacttcagcacccgtgagggaggactccaacaccaag
gccagccccgacaaaaccctcacgccgccaggcagaaccatcgagagcatccggagcatc
ctggagaccatcaaggagctgaggaaagagatgtgtgaccatgatgtcaactgcatgaac
agaaaggaggcactggcggaagtcaatctgcaccttccaaggctgatagaagaagacgga
tgcttcccgccggcggtgaataatgagacctgcctgctgagaatcacttcggggctgatg
gagttccggatgtatctcgagcaccttcaggccaagttcaggagtgacgaagaaaacacc
agggtcagcatggtgctgaagaacatccaacacctgatcaagaccctgaggccaaaggtc
aagaatttgaatgaagaagccaccctcaagccagccgttgcggtcagcctgatggagaac
ctgcagcagaaaaaccagtggctgaagacgaccacgatccacttcatcctgcgcggcctc
acaaacttcctggagttcaccctgcgtgccgtggacctgatggagtgcgggtgtccttgc
ttgcggaatttcatgggctctgcctcccacggtcagaacacaccatcctgtccattggac
acataa

DBGET integrated database retrieval system