KEGG   Oryctolagus cuniculus (rabbit): 100008751
Entry
100008751         CDS       T03373                                 

Gene name
VDAC1
Definition
(RefSeq) voltage dependent anion channel 1
  KO
K05862  voltage-dependent anion channel protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04217  Necroptosis
ocu04218  Cellular senescence
ocu04621  NOD-like receptor signaling pathway
ocu04979  Cholesterol metabolism
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100008751 (VDAC1)
   04022 cGMP-PKG signaling pathway
    100008751 (VDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100008751 (VDAC1)
   04218 Cellular senescence
    100008751 (VDAC1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100008751 (VDAC1)
  09154 Digestive system
   04979 Cholesterol metabolism
    100008751 (VDAC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100008751 (VDAC1)
   05012 Parkinson disease
    100008751 (VDAC1)
   05014 Amyotrophic lateral sclerosis
    100008751 (VDAC1)
   05016 Huntington disease
    100008751 (VDAC1)
   05017 Spinocerebellar ataxia
    100008751 (VDAC1)
   05020 Prion disease
    100008751 (VDAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    100008751 (VDAC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100008751 (VDAC1)
   05164 Influenza A
    100008751 (VDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100008751 (VDAC1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ocu04040]
    100008751 (VDAC1)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    100008751 (VDAC1)
Ion channels [BR:ocu04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   100008751 (VDAC1)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 100008751
NCBI-ProteinID: NP_001075544
Ensembl: ENSOCUG00000009369
UniProt: Q9TT15
LinkDB
Position
3
AA seq 283 aa
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt   +upstreamnt  +downstreamnt
atggctgtacctcccacgtatgccgatcttggcaaatctgccagggatgtcttcaccaag
ggctacggatttggcttaataaagcttgatttgaaaacaaagtccgagaatggattggaa
tttacaagctcaggctcagccaacactgagaccaccaaagtgacgggcagtctggaaacc
aagtacaggtggactgagtacgggctgacgtttacggagaaatggaacaccgacaacacg
ctgggcaccgagatcaccgtggaagaccagcttgcacgtggactgaagctgaccttcgat
tcctccttctcgcctaacactgggaaaaaaaatgctaaaatcaagacaggctacaagcgg
gagcacatcaacctgggctgcgacgtggatttcgacatcgctgggccctccatccggggt
gctctggtgctgggttatgagggctggctggctggctaccagatgaactttgagactgcc
aagtcccgagtcacccagagcaactttgccgtcggctacaagaccgatgaattccagctc
cacactaatgtgaacgacggaacggagtttggcggctccatttaccagaaggtgaacaag
aagctggagacggccgtcaatcttgcctggacagcaggaaacagtaacactcgcttcgga
atagcagccaagtatcagatcgaccctgacgcctgcttctcggcaaaagtgaacaactcc
agcctgataggattaggatacactcagaccctaaagccaggtatcaaactgacgctctca
gctctgctggatggcaagaacgtcaacgctggcggccacaagcttggtctaggactggaa
tttcaagcataa

DBGET integrated database retrieval system