KEGG   Oryctolagus cuniculus (rabbit): 100008806
Entry
100008806         CDS       T03373                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu04151  PI3K-Akt signaling pathway
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04540  Gap junction
ocu04630  JAK-STAT signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu05160  Hepatitis C
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008806 (EGFR)
   04012 ErbB signaling pathway
    100008806 (EGFR)
   04014 Ras signaling pathway
    100008806 (EGFR)
   04015 Rap1 signaling pathway
    100008806 (EGFR)
   04630 JAK-STAT signaling pathway
    100008806 (EGFR)
   04066 HIF-1 signaling pathway
    100008806 (EGFR)
   04068 FoxO signaling pathway
    100008806 (EGFR)
   04020 Calcium signaling pathway
    100008806 (EGFR)
   04072 Phospholipase D signaling pathway
    100008806 (EGFR)
   04151 PI3K-Akt signaling pathway
    100008806 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100008806 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100008806 (EGFR)
   04520 Adherens junction
    100008806 (EGFR)
   04540 Gap junction
    100008806 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100008806 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100008806 (EGFR)
   04915 Estrogen signaling pathway
    100008806 (EGFR)
   04921 Oxytocin signaling pathway
    100008806 (EGFR)
   04926 Relaxin signaling pathway
    100008806 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100008806 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008806 (EGFR)
   05206 MicroRNAs in cancer
    100008806 (EGFR)
   05205 Proteoglycans in cancer
    100008806 (EGFR)
   05230 Central carbon metabolism in cancer
    100008806 (EGFR)
   05231 Choline metabolism in cancer
    100008806 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100008806 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100008806 (EGFR)
   05212 Pancreatic cancer
    100008806 (EGFR)
   05225 Hepatocellular carcinoma
    100008806 (EGFR)
   05226 Gastric cancer
    100008806 (EGFR)
   05214 Glioma
    100008806 (EGFR)
   05218 Melanoma
    100008806 (EGFR)
   05219 Bladder cancer
    100008806 (EGFR)
   05215 Prostate cancer
    100008806 (EGFR)
   05213 Endometrial cancer
    100008806 (EGFR)
   05224 Breast cancer
    100008806 (EGFR)
   05223 Non-small cell lung cancer
    100008806 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100008806 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100008806 (EGFR)
   05171 Coronavirus disease - COVID-19
    100008806 (EGFR)
   05163 Human cytomegalovirus infection
    100008806 (EGFR)
   05165 Human papillomavirus infection
    100008806 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100008806 (EGFR)
   01522 Endocrine resistance
    100008806 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100008806 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100008806 (EGFR)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100008806 (EGFR)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100008806 (EGFR)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100008806 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100008806 (EGFR)
  Exosomal proteins of bladder cancer cells
   100008806 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH Kdo
Other DBs
NCBI-GeneID: 100008806
NCBI-ProteinID: XP_008260065
Ensembl: ENSOCUG00000010481
LinkDB
Position
10
AA seq 1209 aa
MRPSGPVGPALLALLAALLQAGQALEEKRVCQGTSNKLTQLGPFEDHFLSLQRMFNSCEV
VLGNLEITYVQRNHDLSFLKTIQEVAGYVLIALNTVESIPLESLQIIRGNVLYENTYALA
VLSNYGANKTGLRELPMRNLQEILHGAVRFSNNPVLCNVETIQWRDIVHGDFLSNMSLDM
QNPLGSCQKCDPSCPNGSCWGAGGENCQRLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTRTPPLDPEELDILKTVREITGFLLIQAWPENKTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLQEISDGDVIVSGNRDLCYANTINWKKL
FGTSSQKTKIINNRGDKDCKAAGHVCDPLCSSEGCWGPEPRDCVSCRNVSRGKECVERCN
VLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIKCAHFIDGPHCVKTCPAGVM
GENDTLVWKFADAGRICRLCHPNCTYGCAGPGLEGCATNGPKIPSIATGVVGGLFLLVVL
GLGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKLKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLVTQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEIASVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIVEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMGDVIDADEYLIPQ
QGFFNSPSTSRTPLLSSLSATSNSSTMACVDRNGQSCPVKEDSLLQRYSSDPTGGVTEDS
MDDTFLPVPEYINQYIPKRPAGSVQNPVYHNQPLHPAPGRDPHYQDPHSSAVGNPEYLNT
TQPPCPNGIFDSPTPWAQKGSHQMSLDNPDYQQDFFPKDGKLNGIFKGPTAENAEYLRVA
PPGREFTTA
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgcgaccctcggggccggtcgggcccgcgctcctggcgctgctggccgcgctcctgcag
gcgggacaggcgctggaggagaagagagtttgccagggcacaagcaacaagctgacccag
ctgggcccttttgaggaccacttcctgagcctgcagaggatgttcaacagctgtgaggtg
gtgctggggaacctggagatcacctacgtgcagaggaaccacgacctctccttcttaaag
accatccaggaggtggctggctacgtgctcattgccctcaacaccgtggagagcatccct
ttggagagcctgcaaatcatccgaggaaacgtgctgtatgagaacacctacgccttagcc
gttctgtccaactacggagccaacaagaccgggctgagggagctgcccatgcggaacttg
caggaaatccttcatggagctgtgcgattcagcaacaaccctgtcctgtgcaatgtggag
accatccagtggcgggacattgttcacggtgactttctgagcaacatgtctctggacatg
cagaaccccctgggcagctgccagaagtgtgacccaagctgtcccaatggaagctgctgg
ggcgcaggcggcgagaactgccagagactgaccaaaatcatctgcgcccagcagtgctct
ggacgctgccgcggcaagtcccccagcgactgctgccacaaccagtgtgctgctggctgc
acaggcccacgggagagcgactgcttggtctgccgtaaattcagagacgaagccacatgc
aaggacacctgcccacctctcatgctgtacaaccccaccacatatcagatggatgtcaac
cccgagggaaaatacagctttggtgccacctgtgtcaagaaatgtccccgtaactacgtg
gtgacagatcatggctcctgtgtccgggcctgtggtcctgacagctacgaggtggaggaa
gatggcgtccgcaagtgtaagaagtgcgaggggccttgtcgcaaagtttgtaatgggata
ggaattggtgaatttaaagacacgttgtccataaatgccacaaacatcaaacacttcaaa
aactgcacgtccatcagtggtgatctgcacatcctgccggtggcattcaggggggattcc
ttcacccgcaccccgcccctggaccccgaggagctggacatcctgaaaaccgtgcgggag
atcacagggtttctactgattcaggcgtggccagaaaacaagactgacctccatgccttt
gagaacctagaaatcatccgtggcaggacaaagcagcatggtcagttttctcttgcggtt
gtcggcctggacataacatccctgggactgcgctccctccaagagattagcgatggagac
gtgatcgtttcaggaaaccgagacctgtgctatgcaaacacaataaactggaaaaagctt
tttggaacctccagccagaaaaccaaaattatcaacaaccggggagacaaggactgcaag
gccgctggccacgtctgtgacccgctgtgctcatcggagggctgctggggccccgagccc
agggactgtgtctcctgccggaatgtcagccgtggcaaggagtgtgtggagaggtgcaac
gttctggagggtgagcccagggagtttgtggagaactctgagtgcattcagtgccatccg
gaatgtctgccccaggccatgaacatcacctgcacaggacggggtccagataactgcatc
aagtgtgcacacttcatcgatggccctcactgcgtcaagacctgcccagcaggagtcatg
ggggaaaacgacaccctggtctggaagtttgccgacgctggacgcatctgccgcctgtgc
cacccaaactgcacctatggctgtgctgggccaggtctcgaaggctgtgcaacaaatggg
cccaaaatcccctccatcgccacgggggtcgtgggcggcctcttcctgctggtggtgctg
ggcctcggcatcggcctcttcatgcgcaggcgccacattgtccggaagcgcacattgcgc
cgactgctgcaggagagagagctcgtggagcctcttacacccagtggggaggcccccaac
caagccctcctgaggattttaaaggaaacagaattcaagaagctcaaagtcctgggctct
ggagcgtttggcaccgtgtataagggactctggattccagaaggcgagaaagttaaaatc
cctgtggccatcaaggagttaagagaagccacgtctccaaaggccaacaaggagatcctg
gatgaggcctacgtgatggccagcgtggacaacccccatgtgtgtcgcctcctgggcatc
tgcctgacctccactgtgcagctcgtcacacagctcatgcccttcggttgcctgctggac
tacgtccgagagcacaaagacaacatcggctcccagcacctgctcaactggtgtgtgcag
attgcaaagggcatgaactacctggaggaccggcgtctggtgcaccgcgacctggctgcc
aggaatgtgctggtaaagacaccgcaacacgtcaagatcacagattttgggctggccaag
ctgctcggtgcagaggagaaagaataccatgcagaggggggcaaggtccccatcaagtgg
atggctttggaatcgattttacaccggatttacacccaccagagtgatgtctggagctac
ggagtcaccgtttgggagttgatgacctttgggtccaagccttacgacggaatccctgcc
agtgagatcgcgtctgtgctggagaaaggagaacgacttccacagccccccatctgcact
attgacgtctacatgatcatggtcaagtgctggatgatagatgctgacagtcgcccaaag
ttccgggagttgattgtggaattttccaaaatggcccgagaccctcagcgttaccttgtc
attcagggggatgagcggatgcatttgccaagccctacagattccaatttttaccgtgcc
ctgatggacgaagaagacatgggcgacgtcatagatgctgacgagtacctcattcctcag
cagggcttcttcaacagcccctccacatcacggacgccgctcttaagctctctgagtgcg
accagcaacagttccaccatggcttgtgtggataggaacgggcagagctgtcctgtcaag
gaagacagcctcctgcagcggtacagctcagaccccactggtggcgtgactgaggacagc
atggatgacacgtttctcccagtgcctgaatacataaaccagtacattcccaagaggcct
gcaggctctgtgcagaaccctgtctaccataaccagcctctgcacccggctccgggcaga
gacccccactaccaggatccccacagcagcgcagtgggaaaccctgaatatctcaacacc
acccagcctccctgtcccaatggcatctttgacagccccaccccctgggcccagaagggc
agccaccaaatgagcctggacaaccccgattaccagcaagacttttttcccaaggatggc
aagctgaatggcatcttcaagggtcctacggctgaaaacgcagaatacctaagggtagca
ccaccaggccgtgaatttaccacagcgtga

DBGET integrated database retrieval system