KEGG   Oryctolagus cuniculus (rabbit): 100008808
Entry
100008808         CDS       T03373                                 

Gene name
EGF
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04510  Focal adhesion
ocu04540  Gap junction
ocu04630  JAK-STAT signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu05160  Hepatitis C
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05226  Gastric cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008808 (EGF)
   04012 ErbB signaling pathway
    100008808 (EGF)
   04014 Ras signaling pathway
    100008808 (EGF)
   04015 Rap1 signaling pathway
    100008808 (EGF)
   04630 JAK-STAT signaling pathway
    100008808 (EGF)
   04066 HIF-1 signaling pathway
    100008808 (EGF)
   04068 FoxO signaling pathway
    100008808 (EGF)
   04020 Calcium signaling pathway
    100008808 (EGF)
   04072 Phospholipase D signaling pathway
    100008808 (EGF)
   04151 PI3K-Akt signaling pathway
    100008808 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100008808 (EGF)
   04540 Gap junction
    100008808 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100008808 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008808 (EGF)
   05231 Choline metabolism in cancer
    100008808 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100008808 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100008808 (EGF)
   05212 Pancreatic cancer
    100008808 (EGF)
   05226 Gastric cancer
    100008808 (EGF)
   05214 Glioma
    100008808 (EGF)
   05218 Melanoma
    100008808 (EGF)
   05219 Bladder cancer
    100008808 (EGF)
   05215 Prostate cancer
    100008808 (EGF)
   05213 Endometrial cancer
    100008808 (EGF)
   05224 Breast cancer
    100008808 (EGF)
   05223 Non-small cell lung cancer
    100008808 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100008808 (EGF)
   05165 Human papillomavirus infection
    100008808 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100008808 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008808 (EGF)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   100008808 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3
Other DBs
NCBI-GeneID: 100008808
NCBI-ProteinID: XP_017202838
Ensembl: ENSOCUG00000016388
UniProt: G1TBJ6
LinkDB
Position
15
AA seq 1198 aa
MLLLLILLPVVFKFSCVSLAALQPGSCPEGRPEGHGHSPCLGPAPFLIFSHGNSIFRIDP
EGTNHEELVVDAGVSVIMDFHYKEERIYWVDLERQFLQRVFLNGSRQERVCNIEKNVSGM
AINWINEEIIWLNQQEGIITVTDMKGNNSYVLLSTLKYPAHIAVDPVERFIFWSSELAGS
LHRADLNGVKVKTLLEIPEGIAAASLDVFDKRLFWIGHNTDGSSARMCSCDYDGGSVHCS
KHQAQHNLFAMSLFGDRIFYSTWKKRTIWIANKHTGKEMVRIHLNTSFVPPGALKVVHPL
LQPKAVDDAWESEHNLCKLRKEKCRRGECGAGPNFRQCACAEGYTLSRDRKSCEDVNECS
FWNHGCSLGCENTPGSYYCTCPVGFVLLPDGKRCHQLVSCPSNASKCSHGCVLTSDGPLC
FCPEGSVLETDGKTCSGCSSPDNGGCSQLCVPLSPVSWECGCLPGYDLQLDRKSCAAAGP
PPFLLFANSQDIRHMHFDGTDYETLLIQQMGMVFALDHDPVENKIYFAHTALKWIERANV
DGSQRERLIEDGVDLPEGLAVDWIGRRFYWTDRGKSVIEGSNLSGKHREIIIKKNISQPR
GIAVHPVAKRLFWTDLGISPRIESSSLQGSDRLIIASSDLIGPSGITIDYLTDKLYWCDA
EKSTIEMANLDGSKRQRLAQNDVGHPFAVAVFEDHVWFSDWAMPSVIRMNKRTGKNRVRL
RGSMLKPSSLVVVHPLAKPGADPCLHQNGGCEHICEGRFGTAQCSCREGFMKSPDGKKCL
SLNAVQMWAAGGEADPSNQATPLDTLLKSRSSEDNVTESQHMLVTEIMVSEQDDCASVGC
GGRAQCVSEGEAATCQCLKGFSGDGRLCSDIDECEMGITVCPPVSSKCINTEGGYVCHCS
EGYQGDGIHCLDIDECHLGIHSCGENANCTNTEGGYTCMCAGSVSEPGLICPDSVPPFQL
KEDEPSPGRNSFPGCPPSHDGYCLHGGVCMYIEAVDNYACNCVVGYVGERCQHRDLKWWE
LRHTGRGRQRDITVVAVCVVVLVLLLLLGLWGAHSYRTQKLLLKHPKNPYEESSRNVSNS
RPTDGEAGISSCPQPWFVIVKEQDIGNGSQPVVSQDGQAADAGHFSSLRPESLQMTPWRK
EPQIHGVGMEQDHSTPPSSDKGSGPQLMERSFHRPSYGAQPLAVGIEKPHFLLSANPS
NT seq 3597 nt   +upstreamnt  +downstreamnt
atgctgctcttacttattctgttgccagtagtttttaaattcagctgtgtgagtctcgca
gcgctgcagcccgggagctgtcctgaaggccgcccggagggacatgggcactctccttgc
ctgggtcctgcacctttcttaattttctcacatggaaatagcatctttaggattgaccca
gaaggaacaaatcatgaagaattggtagtggatgctggtgtctcagtgatcatggatttt
cattacaaagaggaaagaatctattgggtggatttggaaaggcaatttttacaaagagtt
tttctgaatggctcaaggcaagagagagtgtgcaatatagagaaaaatgtttctggaatg
gcaataaattggataaatgaagaaattatttggttaaatcaacaggaaggaatcattaca
gtaacagatatgaaaggaaacaattcctacgttcttttaagcaccttaaaatatcctgca
catatagcagttgatccagtagaaaggtttatattttggtcttcagagttggccggcagc
cttcacagagccgatctcaatggtgtgaaagtgaagactctgttggagataccagaagga
atagcagctgcatccttggatgtgtttgataagcgactcttttggattgggcacaacaca
gatggaagcagtgctcgtatgtgctcttgtgattatgatgggggctctgtccactgtagc
aaacatcaagcacagcacaatttatttgcaatgtccctttttggtgaccgtatcttctat
tcaacatggaaaaagaggacaatttggatagcaaacaaacacactgggaaggaaatggtt
agaattcacctcaacacgtcatttgtaccacctggtgcacttaaagtagtgcatccactc
ttacagcccaaggcagtggacgatgcctgggagtctgagcacaacctttgcaaactgagg
aaagaaaagtgcagacgcggcgagtgtggagccggccccaacttccgccagtgcgcatgt
gcggagggctacactttgagccgagaccggaagtcttgcgaagatgtaaatgaatgttcc
ttttggaatcatggctgttctcttggatgtgaaaacacccctggatcctattattgcaca
tgcccagtaggatttgttctgcttcctgatgggaaacggtgtcatcaattagtttcctgt
ccaagtaatgcatctaagtgcagccatggctgtgttctgacatcagatggtcctctttgt
ttctgtcctgaaggctctgtgcttgagacagatggaaaaacatgtagtggctgttcatca
cctgataatggtgggtgtagccagctctgcgttcctctcagtccggtatcctgggaatgt
ggttgtctgcctgggtatgacctacaactggatcggaaaagctgtgcagctgcaggacca
ccaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatggaaca
gattatgaaaccctgcttatccagcagatgggaatggtttttgccctagatcatgaccct
gtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaatgtg
gatggttcccaacgagaaaggctaattgaagatggagtagacttgccagaaggacttgct
gtggactggattggccgtcgattctactggacagacagagggaaatctgtcattgaaggg
agtaatctaagtggaaagcatcgtgaaataatcataaagaagaacatttcccaaccacga
ggaattgctgttcatccagtggccaagagattattctggactgatttggggatcagtcca
cggattgaaagttcttcccttcaaggctctgaccgactgatcatagccagctctgatctg
attgggcccagtggaatcacgattgactacttgactgacaaattgtattggtgcgatgcc
gagaagtcgacgattgaaatggccaatctggatggttcaaaacgccaaaggcttgcccag
aatgatgtaggtcatccatttgctgtagctgtttttgaggatcatgtgtggttctcagat
tgggctatgccatcggtaataagaatgaacaagaggactggcaaaaacagggtacgtctg
cgaggcagcatgctgaagccctcatcactggttgtggtccatccattggcaaaaccagga
gcagatccctgcttacatcaaaatggaggctgtgaacatatttgcgaagggagatttgga
actgctcagtgttcgtgtcgtgaaggttttatgaaatccccagatgggaaaaagtgcttg
tctctaaatgctgttcagatgtgggcagcaggtggtgaagcagatccaagtaaccaagca
acaccattggacaccttgttgaagagtagatcctcagaagataatgttacagaatctcaa
cacatgctggtgactgagatcatggtgtcagaacaagatgactgtgcttctgtgggatgt
ggtgggcgtgctcagtgtgtctctgagggagaggctgccacgtgccagtgtttgaaagga
ttttctggggatggaagactctgttctgatatagatgaatgtgagatggggatcacagtt
tgccctcctgtctcctccaagtgcatcaatacagaaggtggctatgtctgccactgctca
gaaggctaccaaggagatgggattcactgtcttgatattgatgagtgccacttggggata
catagctgtggagagaatgccaactgcacaaacacggagggaggctacacttgcatgtgt
gctggcagtgtttctgaacctggactcatttgccctgattctgttccgccatttcagctc
aaggaagatgagccctctccaggcagaaatagtttcccgggatgccccccgtcacatgac
gggtactgcctccatggtggcgtgtgcatgtatattgaagcagtagacaactatgcctgc
aactgtgtggttggctacgtcggggagcgctgtcagcatcgagacttgaagtggtgggaa
ctgcgccacactggccgtggacggcagcgggacatcactgtggtggctgtctgtgtggtg
gtgctggtcctactgctcctcctgggcctgtggggggctcactcctacaggactcagaag
ctgttattgaagcatccaaagaatccttatgaagagtcgagcagaaatgtgagcaacagc
aggcctactgatggcgaggctgggatatcttcttgccctcaaccttggtttgtcattgta
aaagaacaagacatcggcaatgggagtcagcctgtggtgagccaggatggccaggcagca
gatgctgggcacttttcctccctgaggcctgagtccctgcaaatgactccatggaggaag
gagccccagatacatggagtaggcatggagcaagaccactcgactccaccatcaagtgat
aaggggtctggcccccagctaatggagcgaagctttcatcgaccatcttacggggcacag
cctcttgctgtgggaattgaaaagccccattttctcttgtctgctaatccatcatag

DBGET integrated database retrieval system