KEGG   Oryctolagus cuniculus (rabbit): 100008809
Entry
100008809         CDS       T03373                                 

Gene name
HBEGF
Definition
(RefSeq) heparin binding EGF like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04012  ErbB signaling pathway
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu05171  Coronavirus disease - COVID-19
ocu05205  Proteoglycans in cancer
ocu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100008809 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100008809 (HBEGF)
   04915 Estrogen signaling pathway
    100008809 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    100008809 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100008809 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    100008809 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100008809 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100008809 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100008809 (HBEGF)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100008809 (HBEGF)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 100008809
NCBI-ProteinID: XP_008253346
Ensembl: ENSOCUG00000015909
UniProt: G1TAH3
LinkDB
Position
3
AA seq 208 aa
MKLLPSMVLKLFLAAVLSALVTGDSLERLRRGLATGTSNPDPPTGATDQDQLLTPGGGFG
PEVPDLEEADLYRAAFSSKPQALATPSKEERGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYLKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcgatggtgctgaagctctttctggctgcagtgctctccgcgttg
gtgactggtgacagcttggaacggcttcggagagggttggcgactggaaccagcaaccca
gaccctcccactggagctacggaccaggaccagctgctaaccccaggaggtggcttcggc
ccggaagtaccggacttggaagaggcagatctgtacagagctgctttctcctccaagcca
caagctctggccacaccgagcaaggaggaacgtgggaaaagaaagaagaaaggcaagggg
ttagggaagaagagagacccatgtcttcggaaatacaaggacttctgcatccacggagaa
tgcaaatatctgaaggagctccgagccccgtcctgcatctgccacccgggttaccacgga
gagaggtgccatgggctgagcctcccggtggaaaatcgcctgtacacctatgaccacaca
actatcctggctgtggtggccgtggtgctgtcatccgtctgtctgcttgtcatcgtgggg
cttctcatgtttaggtaccataggagaggaggttacgatgtggagaatgaagagaaggtg
aagctgggcatgacgaattcccactga

DBGET integrated database retrieval system