KEGG   Oryctolagus cuniculus (rabbit): 100008815
Entry
100008815         CDS       T03373                                 

Gene name
PRKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04020  Calcium signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04114  Oocyte meiosis
ocu04140  Autophagy - animal
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04310  Wnt signaling pathway
ocu04340  Hedgehog signaling pathway
ocu04371  Apelin signaling pathway
ocu04530  Tight junction
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04713  Circadian entrainment
ocu04714  Thermogenesis
ocu04720  Long-term potentiation
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04727  GABAergic synapse
ocu04728  Dopaminergic synapse
ocu04740  Olfactory transduction
ocu04742  Taste transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04910  Insulin signaling pathway
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04919  Thyroid hormone signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04924  Renin secretion
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu04962  Vasopressin-regulated water reabsorption
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04976  Bile secretion
ocu05012  Parkinson disease
ocu05020  Prion disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05032  Morphine addiction
ocu05034  Alcoholism
ocu05146  Amoebiasis
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008815 (PRKACA)
   04014 Ras signaling pathway
    100008815 (PRKACA)
   04310 Wnt signaling pathway
    100008815 (PRKACA)
   04340 Hedgehog signaling pathway
    100008815 (PRKACA)
   04371 Apelin signaling pathway
    100008815 (PRKACA)
   04020 Calcium signaling pathway
    100008815 (PRKACA)
   04024 cAMP signaling pathway
    100008815 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100008815 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100008815 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100008815 (PRKACA)
   04540 Gap junction
    100008815 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100008815 (PRKACA)
   04062 Chemokine signaling pathway
    100008815 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    100008815 (PRKACA)
   04910 Insulin signaling pathway
    100008815 (PRKACA)
   04922 Glucagon signaling pathway
    100008815 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    100008815 (PRKACA)
   04912 GnRH signaling pathway
    100008815 (PRKACA)
   04913 Ovarian steroidogenesis
    100008815 (PRKACA)
   04915 Estrogen signaling pathway
    100008815 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    100008815 (PRKACA)
   04921 Oxytocin signaling pathway
    100008815 (PRKACA)
   04926 Relaxin signaling pathway
    100008815 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    100008815 (PRKACA)
   04918 Thyroid hormone synthesis
    100008815 (PRKACA)
   04919 Thyroid hormone signaling pathway
    100008815 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    100008815 (PRKACA)
   04916 Melanogenesis
    100008815 (PRKACA)
   04924 Renin secretion
    100008815 (PRKACA)
   04925 Aldosterone synthesis and secretion
    100008815 (PRKACA)
   04927 Cortisol synthesis and secretion
    100008815 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100008815 (PRKACA)
   04270 Vascular smooth muscle contraction
    100008815 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    100008815 (PRKACA)
   04971 Gastric acid secretion
    100008815 (PRKACA)
   04976 Bile secretion
    100008815 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100008815 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100008815 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100008815 (PRKACA)
   04727 GABAergic synapse
    100008815 (PRKACA)
   04725 Cholinergic synapse
    100008815 (PRKACA)
   04728 Dopaminergic synapse
    100008815 (PRKACA)
   04726 Serotonergic synapse
    100008815 (PRKACA)
   04720 Long-term potentiation
    100008815 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    100008815 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    100008815 (PRKACA)
   04742 Taste transduction
    100008815 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    100008815 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    100008815 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    100008815 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100008815 (PRKACA)
   04714 Thermogenesis
    100008815 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008815 (PRKACA)
   05205 Proteoglycans in cancer
    100008815 (PRKACA)
   05203 Viral carcinogenesis
    100008815 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100008815 (PRKACA)
   05020 Prion disease
    100008815 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    100008815 (PRKACA)
   05031 Amphetamine addiction
    100008815 (PRKACA)
   05032 Morphine addiction
    100008815 (PRKACA)
   05034 Alcoholism
    100008815 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100008815 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100008815 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100008815 (PRKACA)
   05163 Human cytomegalovirus infection
    100008815 (PRKACA)
   05165 Human papillomavirus infection
    100008815 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100008815 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100008815 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100008815 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100008815 (PRKACA)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100008815 (PRKACA)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100008815 (PRKACA)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  PKA family
   100008815 (PRKACA)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100008815 (PRKACA)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100008815 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 100008815
NCBI-ProteinID: NP_001075578
UniProt: Q95J97
LinkDB
Position
Un
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAQLDQFERIKTLGTGSFGRVML
SKHKETGNHYAMKILDKQKVVKLKQIEHTLNVKRILQAVNFPFLVKLEFSFKENSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQQTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAADYPPFF
ADQPIQIYEKIVYGKVRFPSHFSSDLKDLLRNLQQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggggaatgcggcagcagcgaagaagggcagcgagcaagagagtgtcaaagagttctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaatacagcgcag
ttggatcagtttgagcgcatcaagaccctcggcacgggctccttcgggcgggtgatgctt
agcaagcacaaagagaccgggaaccactatgccatgaagatcctcgacaaacagaaggtg
gtgaagctgaaacagatcgagcacaccctgaacgttaaacgcattctgcaagcagttaac
ttcccgttcctcgtcaaactcgagttctccttcaaggagaactcaaacttgtacatggtt
atggagtacgtacccggcggggagatgttctcacacctgcggcggattgggaggttcagc
gagccccacgctcgcttctacgccgcgcagatcgtgctgaccttcgagtacctgcactcg
ctggatctcatctaccgggacctcaagcccgagaacctcctcatagaccagcagggctac
atccagcagacagacttcggctttgccaagcgcgtgaaaggccgcacctggaccttgtgc
gggacccccgagtacctggcccctgaaattatcctcagcaaaggttacaataaggccgtg
gactggtgggccctaggagtgctcatctacgagatggctgccgactaccccccgttcttc
gctgaccagcccatccaaatctacgagaagattgtctatgggaaggtgcgattcccgtct
cacttcagctcggacttgaaggacctgctgcggaacctccagcaggtggatctcaccaag
cgcttcgggaacctcaagaacggggtcaacgacatcaagaaccacaagtggtttgccaca
accgactggatcgccatctaccagaggaaggtggaagctcctttcataccaaagtttaaa
ggccccggggacacgagtaactttgacgactatgaggaggaagagatccgagtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

KEGG   Oryctolagus cuniculus (rabbit): 100342212
Entry
100342212         CDS       T03373                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04020  Calcium signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04114  Oocyte meiosis
ocu04140  Autophagy - animal
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04310  Wnt signaling pathway
ocu04340  Hedgehog signaling pathway
ocu04371  Apelin signaling pathway
ocu04530  Tight junction
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04713  Circadian entrainment
ocu04714  Thermogenesis
ocu04720  Long-term potentiation
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04727  GABAergic synapse
ocu04728  Dopaminergic synapse
ocu04740  Olfactory transduction
ocu04742  Taste transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04910  Insulin signaling pathway
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04919  Thyroid hormone signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04924  Renin secretion
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu04962  Vasopressin-regulated water reabsorption
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04976  Bile secretion
ocu05012  Parkinson disease
ocu05020  Prion disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05032  Morphine addiction
ocu05034  Alcoholism
ocu05146  Amoebiasis
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100342212 (PRKACB)
   04014 Ras signaling pathway
    100342212 (PRKACB)
   04310 Wnt signaling pathway
    100342212 (PRKACB)
   04340 Hedgehog signaling pathway
    100342212 (PRKACB)
   04371 Apelin signaling pathway
    100342212 (PRKACB)
   04020 Calcium signaling pathway
    100342212 (PRKACB)
   04024 cAMP signaling pathway
    100342212 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100342212 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100342212 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100342212 (PRKACB)
   04540 Gap junction
    100342212 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100342212 (PRKACB)
   04062 Chemokine signaling pathway
    100342212 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    100342212 (PRKACB)
   04910 Insulin signaling pathway
    100342212 (PRKACB)
   04922 Glucagon signaling pathway
    100342212 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    100342212 (PRKACB)
   04912 GnRH signaling pathway
    100342212 (PRKACB)
   04913 Ovarian steroidogenesis
    100342212 (PRKACB)
   04915 Estrogen signaling pathway
    100342212 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    100342212 (PRKACB)
   04921 Oxytocin signaling pathway
    100342212 (PRKACB)
   04926 Relaxin signaling pathway
    100342212 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    100342212 (PRKACB)
   04918 Thyroid hormone synthesis
    100342212 (PRKACB)
   04919 Thyroid hormone signaling pathway
    100342212 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    100342212 (PRKACB)
   04916 Melanogenesis
    100342212 (PRKACB)
   04924 Renin secretion
    100342212 (PRKACB)
   04925 Aldosterone synthesis and secretion
    100342212 (PRKACB)
   04927 Cortisol synthesis and secretion
    100342212 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100342212 (PRKACB)
   04270 Vascular smooth muscle contraction
    100342212 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    100342212 (PRKACB)
   04971 Gastric acid secretion
    100342212 (PRKACB)
   04976 Bile secretion
    100342212 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100342212 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100342212 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100342212 (PRKACB)
   04727 GABAergic synapse
    100342212 (PRKACB)
   04725 Cholinergic synapse
    100342212 (PRKACB)
   04728 Dopaminergic synapse
    100342212 (PRKACB)
   04726 Serotonergic synapse
    100342212 (PRKACB)
   04720 Long-term potentiation
    100342212 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    100342212 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    100342212 (PRKACB)
   04742 Taste transduction
    100342212 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    100342212 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    100342212 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    100342212 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100342212 (PRKACB)
   04714 Thermogenesis
    100342212 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342212 (PRKACB)
   05205 Proteoglycans in cancer
    100342212 (PRKACB)
   05203 Viral carcinogenesis
    100342212 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100342212 (PRKACB)
   05020 Prion disease
    100342212 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    100342212 (PRKACB)
   05031 Amphetamine addiction
    100342212 (PRKACB)
   05032 Morphine addiction
    100342212 (PRKACB)
   05034 Alcoholism
    100342212 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100342212 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100342212 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100342212 (PRKACB)
   05163 Human cytomegalovirus infection
    100342212 (PRKACB)
   05165 Human papillomavirus infection
    100342212 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100342212 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100342212 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100342212 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100342212 (PRKACB)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100342212 (PRKACB)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100342212 (PRKACB)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  PKA family
   100342212 (PRKACB)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100342212 (PRKACB)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100342212 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 100342212
NCBI-ProteinID: XP_002715938
Ensembl: ENSOCUG00000012937
UniProt: A0A5F9DCK4
LinkDB
Position
13
AA seq 398 aa
MAAYRELPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWD
RSMKEFLAKAKEDFLKKWENPPPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEA
PFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFCEF
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcagcttatagagaactaccgtgtaaccagtatacaggtacaactactgctcttcag
aaattggaaggatttgctagccgtttatttcatagacactctaaaggtactgcacatgat
cagaaaacagccctggaaaatgacagccttcatttctctgaacatactgccttatgggac
agatcaatgaaagaatttctagccaaagccaaagaagactttttgaaaaaatgggagaat
cctcctccgaataatgccggacttgaggattttgaaaggaaaaagacccttggaacgggt
tcatttggaagagtcatgctggtgaaacataaagccactgaacagtattatgctatgaag
atcttagataagcagaaggttgttaaactgaagcaaatagaacataccctgaatgagaaa
agaatattacaggcagtgaattttccttttcttgttcgactggaatattcttttaaggat
aattctaatttatacatggttatggaatatgttcctgggggtgaaatgttttcacatcta
agaagaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgcta
acattcgagtacctccattcactagacctcatctacagagatctaaaaccagaaaatctc
ttaattgaccatcaaggttatatccaggtcacagactttgggtttgccaaaagagttaaa
ggcagaacttggacattatgtggcaccccagaatatttggctccagaaataatcctgagc
aagggctacaataaggcagtggattggtgggcattaggagtgctaatctatgaaatggca
gctggctaccccccattctttgcagaccaaccaattcagatttatgaaaagatcgtttct
ggaaaagtccgattcccatcccacttcagttcagatctcaaagatcttctaaggaaccta
ctgcaagtggatttgacgaaacgatttggaaatctaaagaatggtgtgagtgacataaaa
actcacaaatggtttgccacaacagattggattgctatttaccagaggaaggttgaagct
ccattcataccaaagttcagaggctctggagataccagcaactttgatgactatgaagaa
gaagatatccgtgtctctataacagaaaaatgtgcgaaagaattttgtgaattttag

DBGET integrated database retrieval system