KEGG   Oryctolagus cuniculus (rabbit): 100008833
Entry
100008833         CDS       T03373                                 

Gene name
NOS2, NOS2A
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00220  Arginine biosynthesis
ocu00330  Arginine and proline metabolism
ocu01100  Metabolic pathways
ocu04020  Calcium signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04146  Peroxisome
ocu04371  Apelin signaling pathway
ocu04926  Relaxin signaling pathway
ocu05010  Alzheimer disease
ocu05014  Amyotrophic lateral sclerosis
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05133  Pertussis
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05200  Pathways in cancer
ocu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100008833 (NOS2)
   00330 Arginine and proline metabolism
    100008833 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100008833 (NOS2)
   04066 HIF-1 signaling pathway
    100008833 (NOS2)
   04020 Calcium signaling pathway
    100008833 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100008833 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100008833 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008833 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100008833 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100008833 (NOS2)
   05014 Amyotrophic lateral sclerosis
    100008833 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100008833 (NOS2)
   05152 Tuberculosis
    100008833 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100008833 (NOS2)
   05145 Toxoplasmosis
    100008833 (NOS2)
   05140 Leishmaniasis
    100008833 (NOS2)
   05142 Chagas disease
    100008833 (NOS2)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100008833 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 100008833
NCBI-ProteinID: XP_017204583
Ensembl: ENSOCUG00000001903
LinkDB
Position
19
AA seq 1102 aa
MACPWRFLFKARSQQYDLTEEKDINNNVGKGTSELCSPATQDDPKCHSLSKHQDDSPQPP
AATAKKSPESPGKQDVPPSACPRHVRIRNWGSGMTLQDTLHLKAKEDSTCKSHYCQGAVM
NPKEMIRGPRDRPTPAEELLPQAIEFVNQYYGSFKEAKIEAHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNNGNI
RSAITVFPQRSDGKHDFRVWNSQLIRYAGYHMPDGTIQGDPANTEFTQLCIDLGWKPNFG
RFDVLPLVLQADGRDPELFEIPADIVLEVPMEHPKYEWFRELELKWYALPAVANMLLEAG
GLEFPACPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHRLASLWKDQAVTEINI
AVLHSFQKRNVTIMDHHSAAESFMKHMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYILSPFYYYQVEAWKTHAWQDMKKKPQRRRLQFRVLGRTALFASVLMRKTLAVRVRAT
ILFATETGKSEALARDLGDLFGCAFNPTVLCMDEYQLSNLEREQLLLVVTSTFGNGDSPG
NGEKLKRSLFMLKELTNKFRYAVFGLGSSMYPQFCAFARDIDQKLCHLGASQLAPLGEGD
ELSGQEDAFRSWAVQTFKAACETFGIRGKERIQIPKLYTSSVTWEPHHYRLVQDSQPLDL
NRALSSLHAKNVMTMKLKSLRNLQSPRSSRATVLVQLSCEGSPGLSYLPGEHLGVCPSNQ
PALVQGILERVVDCPDPHQTVHLQILAESGSYWVRDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLSRLATEEAERQRLVTLCQPSEYNKWKLTNSPTFLEVLEEFPSLRLSAAFLLSQL
PNLKPRYYSISSSQDHTPTEVHLTVAVVTYRPRGGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSASGFQLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSEYKGLRGGRMILVFGCRHPD
EDHLYWEELLEMMQKGVLSGVHTAYSRCPASPRCTFKTCCGRSWPTRCCVSSWRSQATST
CVGACAWPGTWPSSSSSWWLPS
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggcctgtccctggaggtttctgttcaaggccagatcccagcaatacgacctgacagag
gaaaaggacatcaacaacaacgtgggcaaaggcaccagtgagctctgcagcccagcgaca
caggatgaccccaagtgtcacagcctcagcaagcaccaagatgactccccccagcccccg
gcagcgacagcaaagaagtctccagaatctcctggcaagcaggacgtgcccccatcggcc
tgcccacggcacgtgagaatcagaaactggggcagtgggatgactctgcaagacactctg
cacctcaaggccaaagaggactccacttgcaagtcccattattgccagggggccgtcatg
aaccccaaagagatgatccgagggccccgggacaggcccacccctgcggaagagctgctc
ccgcaagccatcgagtttgtcaaccagtactacggctccttcaaagaggcaaaaatagag
gcacatctggccagggtggaagcggtcacaaaggagatagaaacaacaggaacctaccag
ctcacgggggatgagctcatcttcgccaccaagcaggcctggcgcaacgcccctcgctgc
atcggcaggatccagtggtccaacctgcaggtctttgatgcccggagctgctccactgca
caggaaatgtttgaacacatctgcaggcatctgcgttacgccaccaacaacggcaacatc
aggtccgccatcaccgtgttcccccagcggagtgacggcaagcacgacttccgagtctgg
aactctcagctcatccggtacgcgggctaccacatgcccgacggcaccatccaaggggac
ccagccaacaccgagttcacgcagctgtgcatcgacctgggctggaagcccaatttcggc
cgcttcgacgtgctgcctctggtcctgcaggccgacggccgggaccccgagctctttgaa
atccccgctgacattgtgctcgaggtgcccatggagcatcccaagtacgagtggttccgg
gagctggagctgaagtggtacgccctgcctgccgtggccaacatgctgcttgaggccggc
ggcctcgagtttcccgcgtgccccttcaacggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaatatcctggaggaggtgggcaggaggatggga
ctggagacgcacaggctggcgtcgctgtggaaagatcaggccgtcacagagatcaacatc
gccgtgctccacagcttccagaagcggaacgtgaccatcatggaccaccactcggcggcc
gagtccttcatgaagcacatgcagaacgagtaccgctcgcgcggcggctgcccggccgac
tggatctggctggtccccccgatgtccgggagcatcacccccgtgttccaccaggagatg
ctcaactacatcctgtcccctttctactactaccaggtagaggcgtggaaaacccacgcg
tggcaggacatgaagaagaagccccagaggagaaggctgcagttccgagtcctggggaga
actgccctctttgcctctgtgctgatgcgcaagaccttggcggtccgtgtcagggccacc
atcctctttgccacggagacgggaaagtcggaagcgctggcccgggacctgggcgacttg
tttggctgcgccttcaaccccacggtcctttgcatggatgaataccagctgagcaacctg
gagcgggagcagctgctgctggtggtgaccagcacgtttggcaatggagactcccccggc
aatggagagaaactgaagaggtccctcttcatgctgaaggagctcaccaacaagttcagg
tacgcggtcttcggcctcggctccagcatgtaccctcagttctgcgcctttgcccgtgac
attgaccagaagctgtgccacctgggggcctcccagctcgccccgctcggcgaaggggat
gagctcagtgggcaggaggacgccttccgcagctgggccgtgcagaccttcaaggcagcc
tgtgagacgtttggcatccgaggcaaagaacgcattcagatccccaaactctacacgtcc
agtgtgacctgggagccgcaccactacaggctcgtgcaggactcccagcctttggacctg
aacagagccctcagcagcctgcacgccaagaatgtgatgaccatgaagctcaaatctctg
cggaatctacagagtccaagatccagccgagccaccgtcctggtgcagctgtcctgcgag
ggcagccctggcctgagctacctgcccggagagcacctcggggtttgccccagcaaccag
ccggccctggtccaaggcatcttggaacgagtagtggactgtcctgacccccaccaaacc
gtgcatctgcagatcctggctgagagcggcagctactgggtcagagacaagaggctgccc
ccctgctcactcagccaagccctcacctacttcctggacatcaccacgcccccaacccag
ctgctgctccagaaactttcccgactggccacggaagaggccgagagacagcggctggtg
accttgtgccagccctcagagtacaacaagtggaagctcaccaacagccccacgttcctg
gaggtgctggaggagttcccgtcgctgcggctgtctgctgccttcctgctgtcccagctg
cccaacctgaagccccgatactactcgatcagctcctcccaggaccacacgcccacggag
gtccacctcaccgtggccgtggtcacgtaccgcccccgaggtggccagggacccctgcac
catggagtctgcagcacgtggctcagcagcctgaagccccaagacccagtgccctgcttc
gtgcggagtgccagcggcttccagctccccgaggacccctcccatccctgcatcctcatt
gggcccggcacgggcatcgcccccttccgcagtttctggcagcagcgactccatgactcc
gagtacaaagggctccggggcggccgcatgatcctggtgttcgggtgccgccacccagac
gaggaccacctgtactgggaggagttgctggagatgatgcagaagggggtgctgagcggg
gtgcacacggcctactcgcgctgcccggccagcccaaggtgtacgttcaagacctgctgc
ggcagaagctggccgacgaggtgctgcgtgtcctcctggaggagccaggccacatctacg
tgtgtgggggcgtgtgcatggcccgggacgtggccctcgtcctcaagcagctggtggctg
ccaagctga

DBGET integrated database retrieval system