KEGG   Oryctolagus cuniculus (rabbit): 100008840
Entry
100008840         CDS       T03373                                 

Gene name
CASP3
Definition
(RefSeq) caspase 3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04010  MAPK signaling pathway
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04650  Natural killer cell mediated cytotoxicity
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04726  Serotonergic synapse
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008840 (CASP3)
   04668 TNF signaling pathway
    100008840 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100008840 (CASP3)
   04215 Apoptosis - multiple species
    100008840 (CASP3)
   04115 p53 signaling pathway
    100008840 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100008840 (CASP3)
   04657 IL-17 signaling pathway
    100008840 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    100008840 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008840 (CASP3)
   05206 MicroRNAs in cancer
    100008840 (CASP3)
   05205 Proteoglycans in cancer
    100008840 (CASP3)
   05203 Viral carcinogenesis
    100008840 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100008840 (CASP3)
   05222 Small cell lung cancer
    100008840 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100008840 (CASP3)
   05012 Parkinson disease
    100008840 (CASP3)
   05014 Amyotrophic lateral sclerosis
    100008840 (CASP3)
   05016 Huntington disease
    100008840 (CASP3)
   05020 Prion disease
    100008840 (CASP3)
   05022 Pathways of neurodegeneration - multiple diseases
    100008840 (CASP3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100008840 (CASP3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100008840 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100008840 (CASP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100008840 (CASP3)
   05133 Pertussis
    100008840 (CASP3)
   05134 Legionellosis
    100008840 (CASP3)
   05152 Tuberculosis
    100008840 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100008840 (CASP3)
   05162 Measles
    100008840 (CASP3)
   05164 Influenza A
    100008840 (CASP3)
   05161 Hepatitis B
    100008840 (CASP3)
   05160 Hepatitis C
    100008840 (CASP3)
   05168 Herpes simplex virus 1 infection
    100008840 (CASP3)
   05163 Human cytomegalovirus infection
    100008840 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100008840 (CASP3)
   05169 Epstein-Barr virus infection
    100008840 (CASP3)
   05165 Human papillomavirus infection
    100008840 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100008840 (CASP3)
   05145 Toxoplasmosis
    100008840 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100008840 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100008840 (CASP3)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     100008840 (CASP3)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C14: caspase family
   100008840 (CASP3)
SSDB
Motif
Pfam: Peptidase_C14 Erf4
Other DBs
NCBI-GeneID: 100008840
NCBI-ProteinID: NP_001075586
Ensembl: ENSOCUG00000006627
UniProt: Q8MJC3
LinkDB
Position
2
AA seq 277 aa
MENNETSVDAKSIKNLETQTIHGSKSMDSGKYLDNSYKMDYPEMGLCIIINNKNFHKNTG
MSSRSGTDVNAANLGETFMNLKYEVRNKNDLTREEIMELMYNVSKEDHSKRSSFICVILS
HGDEGVIYGTNGPIELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDSGIETDSGVDY
DMACQKIPVEADFLYAYSTAPGYYSWRNSEEGSWFIQSLCAMLKEYAHKLEFMHILTRVN
RKVATEFESYSLDATFHAKKQIPCIVSMLTKELYFYH
NT seq 834 nt   +upstreamnt  +downstreamnt
atggagaacaacgaaacctccgtggacgcaaaatctatcaaaaatttggaaacacagacc
atacatggaagcaaatcaatggactctgggaaatatctggacaatagttacaaaatggat
tatcctgaaatgggtttatgcataatcattaacaacaagaactttcataaaaacactgga
atgtcgtcccggtctggtacagatgtaaatgcagcaaacctcggggaaacattcatgaac
ttgaaatacgaagtcaggaataaaaatgatcttacacgtgaagaaatcatggaactcatg
tacaatgtttctaaagaagatcatagcaaaaggagcagttttatttgtgtgattctaagc
cacggtgatgaaggagtcatttatggaacaaatggacctattgaactgaagaaattaaca
agtttcttcagaggagattactgtagaagtctaactggaaaacctaaacttttcattatt
caggcttgccgaggcacagagctggacagtggcatcgagacagacagtggggttgactat
gacatggcatgccagaaaataccggttgaagccgacttcctgtatgcatattccacagca
cctggttactattcctggcgaaattcggaggaggggtcctggttcatccagtccctgtgt
gccatgctgaaagagtacgctcacaaacttgaattcatgcacattcttactcgtgtgaac
cggaaggtagcgacagagttcgagtcctattcccttgatgccacttttcatgcaaagaaa
cagattccatgtattgtgtccatgctcacaaaagaactgtatttttatcactaa

DBGET integrated database retrieval system