KEGG   Oryctolagus cuniculus (rabbit): 100008875
Entry
100008875         CDS       T03373                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01524  Platinum drug resistance
ocu04014  Ras signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04115  p53 signaling pathway
ocu04137  Mitophagy - animal
ocu04140  Autophagy - animal
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04621  NOD-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05145  Toxoplasmosis
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100008875 (BCL2L1)
   04630 JAK-STAT signaling pathway
    100008875 (BCL2L1)
   04064 NF-kappa B signaling pathway
    100008875 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    100008875 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100008875 (BCL2L1)
   04137 Mitophagy - animal
    100008875 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    100008875 (BCL2L1)
   04215 Apoptosis - multiple species
    100008875 (BCL2L1)
   04115 p53 signaling pathway
    100008875 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100008875 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008875 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    100008875 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100008875 (BCL2L1)
   05225 Hepatocellular carcinoma
    100008875 (BCL2L1)
   05220 Chronic myeloid leukemia
    100008875 (BCL2L1)
   05222 Small cell lung cancer
    100008875 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100008875 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    100008875 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    100008875 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100008875 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    100008875 (BCL2L1)
   05162 Measles
    100008875 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    100008875 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100008875 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100008875 (BCL2L1)
   01524 Platinum drug resistance
    100008875 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100008875 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100008875 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100008875 (BCL2L1)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100008875 (BCL2L1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100008875 (BCL2L1)
Transporters [BR:ocu02000]
 Other transporters
  Pores ion channels [TC:1]
   100008875 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 Nitrate_red_del
Other DBs
NCBI-GeneID: 100008875
NCBI-ProteinID: NP_001075604
Ensembl: ENSOCUG00000003201
UniProt: Q9MYW4
LinkDB
Position
4
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTGPEMETPSAINGNPAWHPA
DSPAVNGATGHSSSLDAREVIPMTAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcgcagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccggaaggg
actggaccagagatggagacccccagtgccatcaatggcaacccagcctggcacccggcg
gacagccccgcggtgaacggagccactggccacagcagcagtttggatgcccgggaggtg
atccccatgacagcagtgaagcaggctctgagggaggcaggcgacgagtttgaactgcgg
taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacagcatat
cagagctttgaacaagtagtgaacgaactcttccgggatggggtgaactggggccgcatt
gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtggacaaggagatggag
gtattggtgagtcggatcgcggcgtggatggccacttacctgaatgaccacctggagccc
tggatccaggagaacggcggctgggacacgtttgtggaactctacggcaacaacgcagca
gccgagagccgcaagggccaggagcgcttcaaccgctggttcctgacgggcatgaccgtg
gctggcgtggttctgctgggctccctcttcagtcggaaatga

DBGET integrated database retrieval system