KEGG   Oryctolagus cuniculus (rabbit): 100008890
Entry
100008890         CDS       T03373                                 

Gene name
NR3C1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100008890 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100008890 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ocu03310]
    100008890 (NR3C1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100008890 (NR3C1)
Nuclear receptors [BR:ocu03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100008890 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100008890
NCBI-ProteinID: NP_001075616
Ensembl: ENSOCUG00000011676
UniProt: P59667
LinkDB
Position
3
AA seq 772 aa
MDSKESLSPPGREEVPSSVLRPAERGNVMDLYKTLRGGAPVRVPASSPSLAPAAQPDSKQ
QRLAVDFPKGSASNAQQPDLSRAVSLSMGLYMGETETKVMGSDLAFPQQGQTSLSSGETD
FRLLEESIASLNRSASGADNPRSTAPAAGSAAPTEGFPKTHSDLASERQNPKGQTGGSAG
SAKLHPTDQSTFDILQDLEFSGSPSKDRSESPWRSDLLMDENCLLSPLAGEDDPFLLEGN
SSEDCKPLILPDTKPKIKDNGDLILSNSNNVPLPQVKTEKEDFIELCTPGVIKQEKLGPV
YCQASFSGANIIGNKISAISVHGVSTSGGQMYHYDMNAQQQEQKPLFNVIPPIPVGSENW
NRCQGSGDDNLTSLGTMNFPGRSVFSNGYSSPGMRPDVSSPPSNSTTAAGPPPKLCLVCS
DEASGCHYGVLTCGSCKVFFKRAVKGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAG
MNLEARKTKKKIKGIQQTSTGVSQETSENPSNRTVVPAALPQLTPTLVSLLEVIEPEVLY
AGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMA
FALGWRSYKQSSGNMLCFAPDLVINEQRMTLPYMYDQCKHMLFVSSELKRLQVSYEEYLC
MKTLLLLSTVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSM
HEVVENLLHYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggactccaaagaatcattaagtcccccgggtagagaggaggtccccagcagtgtgctc
aggccggcggagcgcgggaatgtgatggacttgtacaaaaccctaaggggaggagctcct
gtgagggtgcctgcatcttctccctcactggctcctgctgcgcagccggactccaagcag
cagagactcgcggtggactttccgaaaggctcagccagcaatgcccagcagccggatctg
tccagagcagtgtcactctcgatgggattgtatatgggcgagacagaaaccaaagtgatg
ggcagtgacctggctttcccgcagcagggccaaaccagcctttcctctggggaaacggac
ttccggcttctggaagaaagcatcgcgagcctcaacaggtcggctagtggtgcagacaac
cccaggagcacagcgcctgctgctgggtctgccgcccccacagaggggtttccaaaaact
cactctgacctggcctccgaacggcagaatccgaagggccagactggcggcagcgccggc
agtgccaagttgcaccccacagaccaaagcacctttgacattttgcaggatttggagttt
tctggatccccaagtaaagacaggagcgagagcccttggaggtcagacctgttgatggac
gagaactgtctgctttctcctttggcgggagaagatgatccattccttttggaagggaat
tcgagcgaggactgtaagcctcttattttaccggacacgaaacctaaaattaaggataat
ggagatctgatcttatcaaactccaacaatgtaccactgccccaagtgaaaaccgagaaa
gaagatttcatcgaactctgcacccctggggtaattaagcaagagaaactgggcccagtg
tactgtcaggcaagcttttctggggcaaatataattggtaataaaatatctgccatttct
gttcatggcgtgagtacctccggaggacagatgtaccactatgacatgaacgcacagcag
caggagcagaagcctctttttaatgtcattccgccaattcctgttggttcagaaaattgg
aatcgctgccaagggtctggagatgacaacttgacttccctggggactatgaacttccct
ggccggtcggtgttttccaacggctattcaagtccaggaatgagaccagatgtgagctct
cctccatctaactccacgacagcagcaggaccacctcccaaactctgcttggtgtgctct
gatgaagcctcaggatgtcactacggggtcttgacttgtggaagctgcaaagtattcttc
aaaagggcagtgaaaggacagcacaattatctttgtgctggaagaaatgactgtatcatt
gataaaattcgaagaaaaaattgcccagcatgccgatacagaaaatgtcttcaagctgga
atgaacttggaagcacgaaaaacaaagaaaaaaataaaaggaattcagcagaccagcaca
ggagtttcgcaagaaacttctgaaaatccttctaacagaacagtagttcctgcagcatta
ccacaactcaccccaacactggtgtcactgctggaggtcattgaacctgaagtgttgtat
gcagggtatgacagctcggttccagactctacttggaggatcatgaccacactcaacatg
ttaggtgggcggcaagtgattgcagcagtgaaatgggcaaaggcaataccaggattcagg
aacttgcacctggatgaccaaatgaccctcctgcaatactcatggatgtttctcatggca
tttgccctggggtggagatcatataaacaatccagtggaaacatgctatgttttgctcct
gatctggttattaatgagcagagaatgactctaccctacatgtatgaccaatgtaaacat
atgctgtttgtttcctctgagttaaaacggcttcaggtgtcttacgaagaatatctctgt
atgaaaaccttactgcttctctctacagttcctaaagaaggtttgaagagccaagagcta
tttgatgaaatccgaatgacgtacatcaaagagctaggaaaagccattgtcaagagggaa
ggaaactccagtcagaactggcagcgcttttatcaactgacaaaacttttggactctatg
catgaagtggttgaaaatctccttcactattgcttccaaacatttttggataagacgatg
agtattgaattcccagagatgctagctgaaatcatcaccaatcagataccaaaatattca
aatggaaatatcaaaaaacttctgtttcatcagaaatga

DBGET integrated database retrieval system