KEGG   Oryctolagus cuniculus (rabbit): 100008899
Entry
100008899         CDS       T03373                                 

Gene name
VEGFA, VEGF, VEGFA165b
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04370  VEGF signaling pathway
ocu04510  Focal adhesion
ocu04926  Relaxin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05219  Bladder cancer
ocu05323  Rheumatoid arthritis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008899 (VEGFA)
   04014 Ras signaling pathway
    100008899 (VEGFA)
   04015 Rap1 signaling pathway
    100008899 (VEGFA)
   04370 VEGF signaling pathway
    100008899 (VEGFA)
   04066 HIF-1 signaling pathway
    100008899 (VEGFA)
   04020 Calcium signaling pathway
    100008899 (VEGFA)
   04151 PI3K-Akt signaling pathway
    100008899 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100008899 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100008899 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008899 (VEGFA)
   05206 MicroRNAs in cancer
    100008899 (VEGFA)
   05205 Proteoglycans in cancer
    100008899 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100008899 (VEGFA)
   05211 Renal cell carcinoma
    100008899 (VEGFA)
   05219 Bladder cancer
    100008899 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100008899 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100008899 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100008899 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100008899 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100008899 (VEGFA)
   05165 Human papillomavirus infection
    100008899 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100008899 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008899 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100008899 (VEGFA)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   100008899 (VEGFA)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100008899 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 100008899
NCBI-ProteinID: XP_017200644
Ensembl: ENSOCUG00000011610
LinkDB
Position
12
AA seq 215 aa
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVD
IFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQ
DPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaactttctgctttcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaagaaggagacaataaaccccacgaagtg
gtgaagttcatggaagtctaccggcgcagctactgccagccgatcgagaccttggtggac
atcttccaggagtaccctgatgagatcgagtacatattcaagccttcctgcgtgcctctg
gtgcgctgtgggggctgctgcaatgatgaaagcctggagtgcgtgcccaccgaggagttc
aacgtcaccatgcagatcatgcggatcaaacctcaccagggccagcacataggggagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagacagagcaaggcaagaa
aaaaaatcagttcgaggaaagggcaaggggcaaaaacgaaagcgcaagaaatcccggtat
aaatcctggagcgttccctgtgggccttgctcagagcggagaaagcatttgtttgtacaa
gatccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcag
cttgagttaaacgaacgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system