KEGG   Oryctolagus cuniculus (rabbit): 100008965
Entry
100008965         CDS       T03373                                 

Gene name
CDC42
Definition
(RefSeq) cell division cycle 42
  KO
K04393  cell division control protein 42
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04062  Chemokine signaling pathway
ocu04144  Endocytosis
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04530  Tight junction
ocu04660  T cell receptor signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu04912  GnRH signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008965 (CDC42)
   04014 Ras signaling pathway
    100008965 (CDC42)
   04015 Rap1 signaling pathway
    100008965 (CDC42)
   04370 VEGF signaling pathway
    100008965 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100008965 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100008965 (CDC42)
   04520 Adherens junction
    100008965 (CDC42)
   04530 Tight junction
    100008965 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100008965 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100008965 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    100008965 (CDC42)
   04670 Leukocyte transendothelial migration
    100008965 (CDC42)
   04062 Chemokine signaling pathway
    100008965 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100008965 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100008965 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    100008965 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008965 (CDC42)
   05205 Proteoglycans in cancer
    100008965 (CDC42)
   05203 Viral carcinogenesis
    100008965 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100008965 (CDC42)
   05211 Renal cell carcinoma
    100008965 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100008965 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100008965 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100008965 (CDC42)
   05135 Yersinia infection
    100008965 (CDC42)
   05100 Bacterial invasion of epithelial cells
    100008965 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100008965 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100008965 (CDC42)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100008965 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100008965 (CDC42)
   04031 GTP-binding proteins [BR:ocu04031]
    100008965 (CDC42)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100008965 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    100008965 (CDC42)
  Macropinocytosis
   Ras GTPases
    100008965 (CDC42)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100008965 (CDC42)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100008965 (CDC42)
  Exosomal proteins of breast milk
   100008965 (CDC42)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100008965 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 100008965
NCBI-ProteinID: XP_002716037
Ensembl: ENSOCUG00000009986
UniProt: G1SYB4
LinkDB
Position
13
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacgattaagtgcgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg
atttcctacacaacaaacaaatttccatctgagtatgtgccgactgtttttgacaactat
gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg
caagaggattatgatagattacggccgctgagttatccacaaacagatgtatttttagtg
tgtttttcagtggtttctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccattgtccaaagactcctttcttgcttgtcgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag
acggctgaaaagctggcccgtgatctgaaggctgtcaagtatgtggagtgttctgcgctc
acacagaaaggcctaaagaatgtatttgatgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system