Oryctolagus cuniculus (rabbit): 100008965 Help Entry 100008965         CDS       T03373                                  Gene name CDC42 Definition (RefSeq) cell division cycle 42   KO K04393   cell division control protein 42 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04062   Chemokine signaling pathway ocu04144   Endocytosis ocu04360   Axon guidance ocu04370   VEGF signaling pathway ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04660   T cell receptor signaling pathway ocu04666   Fc gamma R-mediated phagocytosis ocu04670   Leukocyte transendothelial migration ocu04722   Neurotrophin signaling pathway ocu04810   Regulation of actin cytoskeleton ocu04912   GnRH signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05135   Yersinia infection ocu05165   Human papillomavirus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100008965 (CDC42)    04014 Ras signaling pathway     100008965 (CDC42)    04015 Rap1 signaling pathway     100008965 (CDC42)    04370 VEGF signaling pathway     100008965 (CDC42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100008965 (CDC42)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100008965 (CDC42)    04520 Adherens junction     100008965 (CDC42)    04530 Tight junction     100008965 (CDC42)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100008965 (CDC42)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     100008965 (CDC42)    04666 Fc gamma R-mediated phagocytosis     100008965 (CDC42)    04670 Leukocyte transendothelial migration     100008965 (CDC42)    04062 Chemokine signaling pathway     100008965 (CDC42)   09152 Endocrine system    04912 GnRH signaling pathway     100008965 (CDC42)   09156 Nervous system    04722 Neurotrophin signaling pathway     100008965 (CDC42)   09158 Development and regeneration    04360 Axon guidance     100008965 (CDC42)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100008965 (CDC42)    05205 Proteoglycans in cancer     100008965 (CDC42)    05203 Viral carcinogenesis     100008965 (CDC42)   09162 Cancer: specific types    05212 Pancreatic cancer     100008965 (CDC42)    05211 Renal cell carcinoma     100008965 (CDC42)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100008965 (CDC42)    04933 AGE-RAGE signaling pathway in diabetic complications     100008965 (CDC42)   09171 Infectious disease: bacterial    05132 Salmonella infection     100008965 (CDC42)    05135 Yersinia infection     100008965 (CDC42)    05100 Bacterial invasion of epithelial cells     100008965 (CDC42)   09172 Infectious disease: viral    05165 Human papillomavirus infection     100008965 (CDC42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100008965 (CDC42)    03036 Chromosome and associated proteins [BR:ocu03036]     100008965 (CDC42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100008965 (CDC42)    04031 GTP-binding proteins [BR:ocu04031]     100008965 (CDC42) Membrane trafficking [BR:ocu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     100008965 (CDC42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     100008965 (CDC42)   Macropinocytosis    Ras GTPases     100008965 (CDC42) Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     100008965 (CDC42) Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of microglial cells    100008965 (CDC42)   Exosomal proteins of breast milk    100008965 (CDC42) GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     100008965 (CDC42) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf PET117 GTP_EFTU Motif Other DBs NCBI-GeneID:  100008965 NCBI-ProteinID:  XP_002716037 Ensembl:  ENSOCUG00000009986 UniProt:  G1SYB4 LinkDB All DBs Position 13 AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP EPKKSRRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacgattaagtgcgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg atttcctacacaacaaacaaatttccatctgagtatgtgccgactgtttttgacaactat gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg caagaggattatgatagattacggccgctgagttatccacaaacagatgtatttttagtg tgtttttcagtggtttctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag ataactcaccattgtccaaagactcctttcttgcttgtcgggacccaaattgatctcaga gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag acggctgaaaagctggcccgtgatctgaaggctgtcaagtatgtggagtgttctgcgctc acacagaaaggcctaaagaatgtatttgatgaagcaatattggctgccctggagcctcca gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system