KEGG   Oryctolagus cuniculus (rabbit): 100008990
Entry
100008990         CDS       T03373                                 

Gene name
IL1B, IL1-BETA
Definition
(RefSeq) interleukin 1 beta
  KO
K04519  interleukin 1 beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01523  Antifolate resistance
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04064  NF-kappa B signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04657  IL-17 signaling pathway
ocu04659  Th17 cell differentiation
ocu04668  TNF signaling pathway
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04940  Type I diabetes mellitus
ocu05010  Alzheimer disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05332  Graft-versus-host disease
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008990 (IL1B)
   04064 NF-kappa B signaling pathway
    100008990 (IL1B)
   04668 TNF signaling pathway
    100008990 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008990 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100008990 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100008990 (IL1B)
   04620 Toll-like receptor signaling pathway
    100008990 (IL1B)
   04621 NOD-like receptor signaling pathway
    100008990 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    100008990 (IL1B)
   04625 C-type lectin receptor signaling pathway
    100008990 (IL1B)
   04659 Th17 cell differentiation
    100008990 (IL1B)
   04657 IL-17 signaling pathway
    100008990 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100008990 (IL1B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100008990 (IL1B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100008990 (IL1B)
   05321 Inflammatory bowel disease
    100008990 (IL1B)
   05332 Graft-versus-host disease
    100008990 (IL1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100008990 (IL1B)
   05020 Prion disease
    100008990 (IL1B)
   05022 Pathways of neurodegeneration - multiple diseases
    100008990 (IL1B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100008990 (IL1B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100008990 (IL1B)
   04932 Non-alcoholic fatty liver disease
    100008990 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100008990 (IL1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100008990 (IL1B)
   05135 Yersinia infection
    100008990 (IL1B)
   05133 Pertussis
    100008990 (IL1B)
   05134 Legionellosis
    100008990 (IL1B)
   05152 Tuberculosis
    100008990 (IL1B)
  09172 Infectious disease: viral
   05162 Measles
    100008990 (IL1B)
   05164 Influenza A
    100008990 (IL1B)
   05168 Herpes simplex virus 1 infection
    100008990 (IL1B)
   05163 Human cytomegalovirus infection
    100008990 (IL1B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100008990 (IL1B)
   05144 Malaria
    100008990 (IL1B)
   05140 Leishmaniasis
    100008990 (IL1B)
   05142 Chagas disease
    100008990 (IL1B)
   05143 African trypanosomiasis
    100008990 (IL1B)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100008990 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008990 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100008990 (IL1B)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100008990 (IL1B)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Haparin
  Cytokines
   100008990 (IL1B)
SSDB
Motif
Pfam: IL1 IL1_propep
Other DBs
NCBI-GeneID: 100008990
NCBI-ProteinID: NP_001075670
Ensembl: ENSOCUG00000023958
UniProt: P14628
LinkDB
Position
2
AA seq 268 aa
MATVPELTSEMMAYHSGNENDLFFEADGPNYMKSCFQDLDLCCPDEGIQLRISCQPYNKS
FRQVLSVVVALEKLRQKAVPCPQAFQDDGLRTFFSLIFEEEPVLCNTWDDYSLECDAVRS
LHCRLQDAQQKSLVLSGTYELKALHLNAENLNQQVVFSMSFVQGEESNDKIPVALGLRGK
NLYLSCVMKDDKPTLQLESVDPNRYPKKKMEKRFVFNKIEIKDKLEFESAQFPNWYISTS
QTEYMPVFLGNNSGGQDLIDFSMEFVSS
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcaacagtacctgagctcaccagtgagatgatggcttaccacagtggcaatgaaaat
gacctgttctttgaggccgatggtcccaattacatgaagagctgcttccaggacctggac
ctctgctgtccagacgagggcatccagctgcgcatctcctgccaaccctacaacaagagc
ttccggcaggtcttgtcagtcgttgtggctctggagaagctgcggcagaaagcagttccc
tgcccacaggccttccaggatgacggcctgagaactttcttttccttaatctttgaagaa
gaacccgtcctctgcaacacctgggatgactacagtcttgagtgtgatgcagtacgatca
ctgcactgcaggctccaggatgcacaacagaaatccttggtgttgtctggcacgtatgag
ctgaaagctctccacctcaatgcagagaatctgaaccaacaagtggtgttctccatgagt
tttgtgcaaggagaagaaagtaacgacaagatacctgtggccttgggcctcagggggaag
aatctgtacctgtcctgcgtgatgaaagacgataaacctaccctgcagctggagagtgta
gaccccaaccgttacccaaagaagaagatggaaaaacgatttgtcttcaacaagatagaa
atcaaggacaagctggaatttgagtctgcccagttccccaactggtacatcagcacctct
cagacagagtacatgcccgtcttcctgggaaacaacagtggcggccaagacctaattgac
ttcagcatggaattcgtgtcttcctaa

KEGG   Oryctolagus cuniculus (rabbit): 100009250
Entry
100009250         CDS       T03373                                 

Gene name
IL1A
Definition
(RefSeq) interleukin 1 alpha
  KO
K04383  interleukin 1 alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04217  Necroptosis
ocu04218  Cellular senescence
ocu04380  Osteoclast differentiation
ocu04640  Hematopoietic cell lineage
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04940  Type I diabetes mellitus
ocu05010  Alzheimer disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05133  Pertussis
ocu05140  Leishmaniasis
ocu05152  Tuberculosis
ocu05162  Measles
ocu05164  Influenza A
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05332  Graft-versus-host disease
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009250 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009250 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100009250 (IL1A)
   04218 Cellular senescence
    100009250 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100009250 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100009250 (IL1A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009250 (IL1A)
   05321 Inflammatory bowel disease
    100009250 (IL1A)
   05332 Graft-versus-host disease
    100009250 (IL1A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009250 (IL1A)
   05020 Prion disease
    100009250 (IL1A)
   05022 Pathways of neurodegeneration - multiple diseases
    100009250 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100009250 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100009250 (IL1A)
   04932 Non-alcoholic fatty liver disease
    100009250 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100009250 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100009250 (IL1A)
   05152 Tuberculosis
    100009250 (IL1A)
  09172 Infectious disease: viral
   05162 Measles
    100009250 (IL1A)
   05164 Influenza A
    100009250 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100009250 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009250 (IL1A)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100009250 (IL1A)
SSDB
Motif
Pfam: IL1 IL1_propep
Other DBs
NCBI-GeneID: 100009250
NCBI-ProteinID: NP_001095154
Ensembl: ENSOCUG00000008771
UniProt: P04822
LinkDB
Position
2
AA seq 267 aa
MAKVPDLFEDLKNCFSENEEYSSAIDHLSLNQKSFYDASYEPLHEDCMNKVVSLSTSETS
VSPNLTFQENVVAVTASGKILKKRRLSLNQPITDVDLETNVSDPEEGIIKPRSVPYTFQR
NMRYKYLRIIKQEFTLNDALNQSLVRDTSDQYLRAAPLQNLGDAVKFDMGVYMTSEDSIL
PVTLRISQTPLFVSAQNEDEPVLLKEMPETPRIITDSESDILFFWETQGNKNYFKSAANP
QLFIATKPEHLVHMARGLPSMTDFQIS
NT seq 804 nt   +upstreamnt  +downstreamnt
atggccaaagtccctgatctgtttgaagacctaaagaactgtttcagtgaaaatgaggaa
tacagctctgccattgaccatctttctctgaatcagaaatccttctatgatgcaagctat
gaaccacttcatgaagactgcatgaataaagttgtgtctctgagtacctctgaaacctct
gtgtcacccaacctcaccttccaggagaatgtggtggcagtaacagccagtgggaagatt
ctgaagaaaagacgcttgagtttaaaccagcccatcactgatgttgacctggagaccaat
gtcagtgatccagaagaaggaatcatcaagcccagatcagttccttacaccttccagaga
aatatgagatacaaatacttgagaatcatcaaacaagagtttaccctgaatgatgctctc
aatcaaagcctagttcgtgacacctcagatcagtacctcagggcagctccactacaaaat
ctgggcgatgcagtgaaatttgacatgggggtctacatgacatcagaggattctatactt
cctgtaactttaagaatctcacaaactccactgtttgtgagtgcccagaatgaagatgaa
cctgtgctgctaaaggaaatgcctgagacacccaggatcatcacagacagcgagagtgac
atcctcttcttctgggaaactcaaggcaataagaactacttcaagtcagcagccaaccca
cagctgtttattgccacaaagccagaacatctggtgcacatggcaagggggttaccttcg
atgactgattttcagatctcataa

DBGET integrated database retrieval system