KEGG   Oryctolagus cuniculus (rabbit): 100008993
Entry
100008993         CDS       T03373                                 

Gene name
MMP9
Definition
(RefSeq) matrix metallopeptidase 9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04670  Leukocyte transendothelial migration
ocu04915  Estrogen signaling pathway
ocu04926  Relaxin signaling pathway
ocu05161  Hepatitis B
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05215  Prostate cancer
ocu05219  Bladder cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100008993 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100008993 (MMP9)
   04670 Leukocyte transendothelial migration
    100008993 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100008993 (MMP9)
   04926 Relaxin signaling pathway
    100008993 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008993 (MMP9)
   05202 Transcriptional misregulation in cancer
    100008993 (MMP9)
   05206 MicroRNAs in cancer
    100008993 (MMP9)
   05205 Proteoglycans in cancer
    100008993 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    100008993 (MMP9)
   05215 Prostate cancer
    100008993 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100008993 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100008993 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100008993 (MMP9)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     100008993 (MMP9)
Peptidases and inhibitors [BR:ocu01002]
 Metallo peptidases
  Family M10
   100008993 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PT PG_binding_1 Peptidase_M66 Reprolysin_4 DUF4953 Reprolysin_3
Other DBs
NCBI-GeneID: 100008993
NCBI-ProteinID: NP_001075672
Ensembl: ENSOCUG00000016101
UniProt: P41246
LinkDB
Position
Un
AA seq 707 aa
MSPRQPLVLALLVLGCCSAAPRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASM
HGDSQSLRLPLLLLQKHLSLPETGELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHN
ITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNADGAPCHFPFTFEGRS
YTACTTDGRSDGMAWCSTTADYDTDRRFGFCPSERLYTQDGNADGKPCEFPFIFQGRTYS
ACTTDGRSDGHRWCATTASYDKDKLYGFCPTRADSTVVGGNSAGELCVFPFVFLGKEYSS
CTSEGRRDGRLWCATTSNFDSDKKWGFCPDKGYSLFLVAAHEFGHALGLDHSSVPERLMY
PMYRYLEGSPLHEDDVRGIQHLYGPNPNPQPPATTTPEPQPTAPPTACPTWPATVRPSEH
PTTSPTGAPSAGPTGPPTASPSAAPTASLDPAEDVCNVNVFDAIAEIGNKLHVFKDGRYW
RFSEGSGRRPQGPFLIADTWPALPAKLDSAFEEPLTKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGPEVPHVTGALPRAGGKVLLFGAQRFWRFDVKTQTVDSRSGAPVDQMFPGVPLN
THDVFQYREKAYFCQDRFFWRVSTRNEVNLVDQVGYVSFDILHCPED
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgagccccagacagcccctggtcctggcgctcctcgtgctgggctgttgctcagccgcc
cctcgccgccgccagcccaccttggtggtcttcccaggagagctgagaaccaggctcacc
gacaggcagctggcagaggagtacctgttccgctatggttacacccgcgtagccagcatg
cacggagacagccagtccctgcggctgccgctgctacttctgcagaagcatctgtccctg
ccggagacgggggagctggataatgccaccctggaggccatgcgggccccgcgctgcggc
gtcccggacgtgggcaaattccagaccttcgagggtgacctcaagtggcaccaccacaac
atcacgtactggatccaaaactactccgaagacctgccgcgcgacgtcatcgacgacgcc
ttcgcccgcgcctttgcgctgtggagcgcggtgacgccactcaccttcacccgcgtgtac
agccgggacgcagacattgtcatccagtttggggtcgcggagcacggagacgggtatcct
ttcgacggcaaggacgggctcctggcgcacgccttccctcctggccccggcattcaggga
gatgcccacttcgacgacgaagagctgtggtccctgggcaagggcgtcgtggttcccacg
tactttggaaacgccgacggcgccccctgccacttccccttcaccttcgagggccgctcc
tacaccgcctgcaccacggacggccgctctgacggcatggcctggtgcagcaccacggcc
gactatgacaccgaccgtcggtttggcttctgccccagcgaaagactctacacccaggac
ggcaacgcagacggcaagccctgcgagtttccgttcatcttccagggccgtacctactcc
gcctgcaccacggacggccgctccgacggccaccgctggtgcgccaccaccgccagctac
gacaaggacaagctctacggcttctgcccgacccgagctgactccacggtggtcgggggc
aactcggcgggagagctgtgtgtcttccccttcgtcttcctgggcaaagagtactcgtcc
tgtaccagcgagggtcgcagggatgggcgcctctggtgtgccaccacttccaactttgac
agcgacaagaagtggggcttctgccctgataaaggatacagcctgttcctcgtggcagcc
cacgagttcggccatgcactgggcttggatcactcctctgtgccggagcgcctcatgtac
cccatgtaccgctacctagaggggtcccccctgcacgaggacgacgtcaggggcatccag
catctatatggtcctaaccccaacccccagcctccagccaccaccacacctgagccgcag
cccacggctcccccgacggcctgccccacctggccggccactgtgcgcccctccgagcac
cccactaccagccctaccggcgccccctcagctggccctaccggtccccccacggccagc
ccctctgcggcccccactgcgtccttggacccagctgaagacgtctgcaacgtgaatgtc
ttcgacgccatcgccgagatagggaacaagctgcatgtcttcaaggatgggaggtactgg
cggttctccgagggcagtgggcgccggccgcagggccccttcctcatcgccgacacctgg
cccgcgctgccggccaagctggactccgcctttgaggagccgctcaccaagaagctgttc
ttcttctcggggcgccaagtgtgggtgtacacaggcgcgtcggtgctgggcccgaggcgt
ctggacaagctgggcctgggtcccgaggtgccgcacgtcaccggagccctcccgcgcgcc
gggggcaaggtgctgctgttcggcgcgcagcgcttctggaggttcgacgtgaagacgcag
acggtggattcccggagcggcgctccggtggatcagatgttccccggggtgcctttgaac
acacacgacgtcttccagtaccgagagaaagcctacttctgccaggaccgcttcttctgg
cgtgtgagtacccggaacgaggtgaacctagtggaccaggtgggctacgtgagctttgac
atcctgcactgccctgaggactag

KEGG   Oryctolagus cuniculus (rabbit): 100009000
Entry
100009000         CDS       T03373                                 

Gene name
MMP2
Definition
(RefSeq) matrix metallopeptidase 2
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04670  Leukocyte transendothelial migration
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04926  Relaxin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05219  Bladder cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100009000 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100009000 (MMP2)
   04915 Estrogen signaling pathway
    100009000 (MMP2)
   04926 Relaxin signaling pathway
    100009000 (MMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009000 (MMP2)
   05205 Proteoglycans in cancer
    100009000 (MMP2)
  09162 Cancer: specific types
   05219 Bladder cancer
    100009000 (MMP2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100009000 (MMP2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100009000 (MMP2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100009000 (MMP2)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     100009000 (MMP2)
Peptidases and inhibitors [BR:ocu01002]
 Metallo peptidases
  Family M10
   100009000 (MMP2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 Reprolysin_4
Other DBs
NCBI-GeneID: 100009000
NCBI-ProteinID: NP_001075678
Ensembl: ENSOCUG00000006714
UniProt: P50757
LinkDB
Position
5
AA seq 662 aa
MEALGARGALAGFLRALCVLGCLLGRATAPPSPVIKFPGDVAPKTDKELAVQYLNTFYGC
PKDSCNLFVLKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSNVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYTSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGT
SYSSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTIGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATSTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDAGTDAGTGPTPTLGPVTPEICTQDIVFDGI
AQIRGEIFFFKDRFIWRTVTPGDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGN
EYWVYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKM
DPGFPRLIADAWNAIPDHLDAVVDLQGSGHSYFFKGTYYLKLENQSLKSVKVGSIKTDWL
GC
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggaggcgctaggggcccggggcgcgctcgccggcttcctgcgggcgctctgcgtcctg
ggctgcctgctgggccgcgccaccgccccgccgtctcccgtcatcaaattccccggcgat
gtcgcccccaaaacggacaaagagctggcggtgcaatacctgaacaccttctacggctgc
cccaaggacagttgcaacctgttcgtgctgaaggacaccctcaagaagatgcagaagttc
ttcgggctgccccagacaggtgaactggaccagagcaccatcgagaccatgcggaagccg
cgctgcggcaacccggatgtggccaactataacttcttcccccgcaagcccaagtgggac
aagaatcagatcacatacaggatcatcggctacacgcctgacctcgacccggaaacagtg
gatgatgccttcgcgcgcgccttccaagtctggagtaacgtgaccccgctgcggttttct
cgaatccacgatggagaagctgacatcatgatcaactttggccgctgggagcatggagac
ggatacccgtttgacggcaaggacgggctcctggctcatgcctttgctccgggcactggt
gttgggggagattcccactttgatgatgatgagctgtggaccctgggagaaggtcaagtg
gtccgtgtgaagtatggcaatgccgatggggagtactgcaagttccccttcctgttcaat
ggcaaggagtacaccagctgcacagacaccggtcgcagcgatggcttcctctggtgctcc
accacctacaactttgagaaggatggcaagtacggcttctgcccccatgaagccctgttc
accatgggtggcaacgccgatgggcagccctgcaagttcccgttccgcttccaaggcaca
tcctacagcagctgcaccacggaaggccgcaccgacggctaccgctggtgcggcaccacc
gaggactacgaccgcgacaagaagtatggcttctgccccgagactgccatgtctactatt
ggcgggaactcggaaggcgccccctgtgtcttccccttcaccttcctgggcaacaagtat
gagagctgtaccagcgccggccgcagtgatggcaagatgtggtgcgcgacctcaaccaac
tacgacgatgaccgcaagtggggcttctgccctgaccaaggttacagcctgttcctcgtg
gcagcccatgagtttggccacgccatggggctggagcactcccaggaccccggggccctg
atggcgcccatttacacctacacgaagaacttccgcctgtcacaggatgacatcaagggc
attcaagagctctacggggcctctcccgacgctggcacggacgctggcaccggccccacg
cctacgctgggacctgtcactcctgagatctgcacacaggacatcgtcttcgatggcatc
gctcagatccgtggggagatcttcttcttcaaggaccggttcatttggcggacggtgaca
ccgggtgacaagcccatgggacccctgctggtggccaccttctggcctgagctcccggag
aagatcgacgctgtgtacgaggccccccaggaggagaaggccgtgttctttgcaggcaat
gaatactgggtgtattcagccagcaccctggagcgagggtaccccaagcctctgaccagc
ctcgggctgccccccgatgtccagcgagtagacgcggccttcaactggagcaagaacaag
aagacgtacatctttgctggagacaagttctggagatacaatgaggtgaagaagaagatg
gaccctggcttccctcggctcatcgcggatgcctggaacgccatccccgatcacctggat
gctgtggtggacctgcagggcagcggtcacagctacttcttcaagggcacttattacctg
aagctcgagaaccaaagtctgaagagcgtgaaggttggaagcatcaagacggactggctg
ggctgctga

KEGG   Oryctolagus cuniculus (rabbit): 100009110
Entry
100009110         CDS       T03373                                 

Gene name
MMP1, MMP-1
Definition
(RefSeq) matrix metallopeptidase 1
  KO
K01388  matrix metalloproteinase-1 (interstitial collagenase) [EC:3.4.24.7]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03320  PPAR signaling pathway
ocu04657  IL-17 signaling pathway
ocu04926  Relaxin signaling pathway
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05219  Bladder cancer
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100009110 (MMP1)
  09152 Endocrine system
   03320 PPAR signaling pathway
    100009110 (MMP1)
   04926 Relaxin signaling pathway
    100009110 (MMP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009110 (MMP1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100009110 (MMP1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009110 (MMP1)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100009110 (MMP1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.7  interstitial collagenase
     100009110 (MMP1)
Peptidases and inhibitors [BR:ocu01002]
 Metallo peptidases
  Family M10
   100009110 (MMP1)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_3 Reprolysin_5 Reprolysin_4 DUF4953 Peptidase_M66 Peptidase_M54
Other DBs
NCBI-GeneID: 100009110
NCBI-ProteinID: NP_001164610
Ensembl: ENSOCUG00000017958
UniProt: P13943
LinkDB
Position
1
AA seq 468 aa
MPGLPLLLLLLWGVGSHGFPAASETQEQDVEMVQKYLENYYNLKDDWRKIPKQRGNGLAV
EKLKQMQEFFGLKVTGKPDAETLKMMKQPRCGVPDVAQFVLTPGNPRWEQTHLTYRIENY
TPDLSRADVDNAIEKAFQLWSNVTPLTFTKVSKGQADIMISFVRGDHRDNSPFDGPEGQL
AHAFQPGLGIGGDVHFDEDDRWTKDFRNYNLYRVAAHELGHSLGLSHSTDIGALMYPNYM
FSGDVQLAQDDIDGIQAIYGPSQNPSQPVGPQTPKVCDSKLTFDAITTIRGEIMFFKDRF
YMRANPYYSEVELNFISVFWPHLPNGLQAAYEVAHRDEILFFKGNKYWTVQGQNELPGYP
KDIHSSFGFPRSVNHIDAAVSEEDTGKTYFFVANKYWRYDEYKRSMDAGYPKMIEYDFPG
IGNKVDAVFKKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgcccggcttgcctctgctgctgctactgctctggggagtgggctcccatggcttccca
gcagcttcagaaacacaagagcaagatgtggagatggtccagaaatacctggaaaactac
tacaatctgaaggatgattggaggaaaattccaaagcagagaggcaatggcctagcagtt
gagaagctgaagcaaatgcaggaattctttgggctgaaagtgactgggaagccagatgct
gaaaccctgaagatgatgaagcaacccaggtgtggagtgcctgatgtggctcagttcgtc
ctcactccagggaaccctcgttgggaacaaacacatctgacttacagaattgaaaattac
acaccagacctgtcaagggcagatgtggacaatgccattgagaaagcttttcaactctgg
agtaatgtcacacccctgacattcaccaaagtctccaagggtcaagcagacatcatgata
tcctttgtcaggggagatcatcgtgacaattctccctttgatggacctgaaggacagctc
gctcatgcttttcaaccaggcctgggcattggaggggatgttcattttgatgaagatgac
aggtggaccaaagatttcagaaattacaacctgtatcgtgttgcagctcatgaactgggc
cattcccttggactctcccattctactgatattggggctttgatgtaccccaactatatg
ttcagtggtgatgttcagttagctcaggatgacattgatggcatccaagccatatatgga
ccttcccaaaatcccagtcagccagtaggcccacagaccccaaaagtgtgtgatagtaaa
ctgacctttgatgctataaccacaattcggggagaaataatgttctttaaagacaggttc
tacatgcgggcaaatccctactactcagaagttgagctcaatttcatctctgttttctgg
ccacatctgcctaatggacttcaagctgcttatgaagttgcccatagagatgaaattctg
tttttcaaaggtaacaagtactggactgtgcaggggcagaatgagctaccaggatacccc
aaggacattcacagctcctttggcttccctagaagtgtgaatcatattgacgctgctgtt
tctgaggaggatactggaaaaacatacttctttgttgctaacaagtactggaggtatgat
gaatataaacgatctatggatgcaggttatcccaaaatgatagaatatgacttcccagga
attggaaacaaggttgacgctgttttcaagaaagatggatttttctatttctttcatgga
acaaggcaatacaaatttgatcctaaaacgaagagaattctgactctccagaaagctaat
agctggttcaactgcaggaaaaattga

DBGET integrated database retrieval system