KEGG   Oryctolagus cuniculus (rabbit): 100009013
Entry
100009013         CDS       T03373                                 

Gene name
EIF2AK2
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 2
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04141  Protein processing in endoplasmic reticulum
ocu04217  Necroptosis
ocu05010  Alzheimer disease
ocu05160  Hepatitis C
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100009013 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100009013 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100009013 (EIF2AK2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009013 (EIF2AK2)
  09172 Infectious disease: viral
   05162 Measles
    100009013 (EIF2AK2)
   05164 Influenza A
    100009013 (EIF2AK2)
   05160 Hepatitis C
    100009013 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    100009013 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009013 (EIF2AK2)
   05169 Epstein-Barr virus infection
    100009013 (EIF2AK2)
   05165 Human papillomavirus infection
    100009013 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009013 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100009013 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100009013 (EIF2AK2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100009013 (EIF2AK2)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   100009013 (EIF2AK2)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100009013 (EIF2AK2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     100009013 (EIF2AK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm Kinase-like Pkinase_fungal ABC1 DND1_DSRM FTA2 Kdo
Other DBs
NCBI-GeneID: 100009013
NCBI-ProteinID: NP_001075682
Ensembl: ENSOCUG00000007223
UniProt: Q287T5
LinkDB
Position
2
AA seq 547 aa
MANDLSPGFFIEELNKYRQKHSILLKYHELPQSGPPHDVTFTFKVIINEREFPEAEGKSK
KEAKNAAAKIAVDILNKENKEVSPLSLETTNTSEGSSIGNYIGLINRVAQKAKLTVNYEP
CELWEQGPKRFQYKCRIGLKVYGTGIGSTKQEAKQLAAKSAYHKILSEGTLMTINSTSPG
SVATTINDFRNIALVSHTCGSESPSENYFSTTVPEGSYNDDSLNNSSSSSMNVSRNNHKK
IKRHLAPTFNLPDKEASKYTVNPRFANDFKEIEPIGAGGFGQVFKAKHRIDGKTYVIKRV
KYDSEKVEREVKALAALTHPNIVHYYGCWVGHDYDPESSNSDTENSMNMNLGVKTRCLLI
QMEFCDLGTLDQWIETRSHQKSEKALALEFFWQITTGLKYIHSKELIHRDLKPNNIFLVA
INQIKIGDFGLVTSLQNNEKRTVNKGTLRYMSPEQISSQNYGKEVDIYALGLILAELLHI
CTTVVETAKIFAELRRGIFPDVFDIKEKTLLQKLLALEPEKRPDTSEILKTLAEWKNVSD
KKQRYTY
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggccaatgatctttcaccaggtttcttcatagaagaacttaacaaataccgtcagaaa
cacagcatactacttaagtatcatgaactgccccagtcggggcccccgcatgatgtgacg
tttacctttaaagttataataaatgaaagagaatttccagaagctgaaggtaaatcaaag
aaggaagcaaaaaatgctgcagccaaaatagctgttgatatacttaataaagaaaataag
gaagttagtcctttatcgctggaaacaacgaatacttcagaggggtcatccattgggaat
tacatcggccttatcaatagggttgctcagaaggcaaaactaactgtaaattatgaacca
tgtgaactgtgggagcaggggcccaaaagatttcagtataaatgccgaattgggctgaaa
gtatatggtaccggtattggttctactaaacaggaggcaaaacagttggctgctaaatct
gcatatcataagatactatcagaaggaaccttaatgacaattaactctacttctcctggt
tctgttgctactacaattaatgacttcagaaacatcgctttggtatcacacacatgtggt
tctgaatcgccatctgaaaattacttctcaacaactgtgccagaaggaagttataatgat
gacagtttaaacaattcttcgtcatcttctatgaatgtctccagaaataatcataagaag
ataaaaaggcatttggcgcctacatttaacctgcctgataaagaagcaagcaagtatact
gtgaaccccaggttcgccaacgattttaaagaaatagaaccaattggcgcaggtggattt
ggccaagttttcaaagcaaagcacagaattgatggaaagacttatgttatcaaacgtgtt
aaatatgatagtgagaaggtagagcgtgaagtcaaagcattagcagcactcactcatccc
aatattgttcactactacggttgttgggtcgggcatgattatgatcctgagagcagtaat
tcggataccgaaaacagcatgaatatgaatttaggagtgaagactaggtgccttttgata
caaatggaattctgtgacctagggacattggaccaatggattgaaaccagaagccaccag
aaatcagaaaaagctttggctttggagtttttttggcaaataacaacaggactgaaatat
atacattctaaagagttaattcatagagacctgaagccaaataacatatttttagtggct
ataaaccaaataaaaatcggagactttggacttgtaacatccctccaaaataatgaaaag
cgaacagttaataagggaactttacgatatatgagtccagaacagatttcttcccaaaac
tatgggaaggaagtggacatctatgctttggggctcattcttgctgaacttcttcacata
tgcaccacagttgtagaaacagcgaagattttcgccgagctaaggaggggcattttccca
gatgtgtttgacattaaagaaaaaactctgctacagaaattacttgcattggagcctgag
aaacgacctgacacgtctgaaatactgaagactttggctgagtggaagaatgtctcagac
aaaaagcaaagatacacgtattag

DBGET integrated database retrieval system