KEGG   Oryctolagus cuniculus (rabbit): 100009024
Entry
100009024         CDS       T03373                                 

Gene name
TLR3
Definition
(RefSeq) toll like receptor 3
  KO
K05401  toll-like receptor 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100009024 (TLR3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100009024 (TLR3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100009024 (TLR3)
   05161 Hepatitis B
    100009024 (TLR3)
   05160 Hepatitis C
    100009024 (TLR3)
   05168 Herpes simplex virus 1 infection
    100009024 (TLR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009024 (TLR3)
   05165 Human papillomavirus infection
    100009024 (TLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ocu04054]
    100009024 (TLR3)
   04090 CD molecules [BR:ocu04090]
    100009024 (TLR3)
Pattern recognition receptors [BR:ocu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100009024 (TLR3)
CD molecules [BR:ocu04090]
 Proteins
  100009024 (TLR3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD TIR LRR_9 LRR_1 TIR_2 LRRNT LRRCT
Other DBs
NCBI-GeneID: 100009024
NCBI-ProteinID: NP_001075688
Ensembl: ENSOCUG00000017763
UniProt: A0ELV4
LinkDB
Position
2
AA seq 905 aa
MSQSVPYHISSLWGLLSLWMLCTSSGNKCTVRQEVADCSHLKLTQIPDDLPTNITVLNLT
HNQIKRLPPANFTRYSRLTVLDGGFNTISKLEPELCQSLPSLKVLNLQHNELSQLSDKTF
VFCMNLTELHLMSNSIQKIQNNPFKNQKNLIKLDLSHNGLKSTKLGTQLQLQNLQELLLS
KNKIQALKSEELAFLGNSSLKKLELSSNLIKEFSPGCFHAIGQLFGLFLNNAQLGPSLIE
KLCLELSNTSIQNLSLSNSQLNRISNRTLLGLKHTNLTMLDLSHNNLNMIDDDSFVWLPH
LKYLFLEYNNIVHLSNHSFYGLFNVRHLNLKRSFPKQSVSLTSLPKIDDFSFQWLRCLEY
LNMEDNDIPSIKRNMFTGLINLRYLSLSNSFTNLRTLKNETFSSLAHSPLLILNLTKNKI
SKIESDAFSWLGSLEVLDIGINEIGQELTGQEWRGLENIFEIYLSYNKYLQLTSNSFALV
PSLQRLMLRRVALKNVDISPSPFHPLHDLTILDLSNNNLANINEEMLEGLEKLEVLDLQH
NNLARLWKQANPGGPVHFLKGLSHLHTLNLESNGLDEIPEGVFKNLFQLKSINLALNNLN
VLPQSVFDDQVSLKSLNLQKNLITSVEKKVFGPVFKNLSNLDMSFNPFDCTCESIAWFVN
WINKTRTNISELSSHYLCNTPPQYHGFSVRLFDTSSCKDSAPFELLFMINTSFLLLFIFI
VLLIHFEGWRISFYWNVSVHRILGFKEIDGQPEQFEYTAYIIHAYKDRDWVWEHFSSMEE
EDPSIKFCLEERDFQAGVLGLEAIVNSIKRSRKIIFVITQHLLKDPLCKRFKVHHAVQQA
IEQNLDSIILIFLENIPDYKLNHALCLRRGMFKSRCIFYWPVHKERIEAFHHKLQVALGS
RNSLH
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgagccagagtgtgccttatcacatctcctctctttggggactgttgtccctttggatg
ctgtgtacctcctccggcaataaatgcacggtgagacaggaagtagccgactgcagccat
ctgaagttgactcaaatacctgatgacctgcccaccaacataacagtgttaaatcttacc
cacaaccagatcaaaagattgccacctgccaattttacaaggtatagccggcttactgtc
ttggacggaggatttaacaccatctcaaagctggagccagaattgtgccaaagccttcct
tcgctgaaggttttgaacctccaacacaatgagctttctcagctttcagataaaaccttt
gttttctgcatgaatttgactgaactccatttaatgtccaattcaatccagaaaattcaa
aataatccctttaaaaaccagaagaatttaatcaaattagatctgtctcataatggttta
aaatctacaaaactggggactcagctccagctgcaaaatctccaagagcttctactatca
aaaaacaaaattcaggcactgaaaagtgaagagcttgctttcctcggcaattcttctcta
aaaaaattagagttgtcatcaaatctaattaaagagttttctccagggtgtttccatgca
attggacaattatttggcctctttctgaacaatgcccaacttggcccaagtctcatagag
aagctttgtttggagttatcaaacactagcattcagaatctgtctctgagtaacagccag
ctgaacagaatcagcaataggactttgcttggactgaagcacaccaacctcaccatgctc
gacctttcccacaataacttgaatatgatcgatgatgattcctttgtttggcttccacat
ctcaaatatctcttcctggagtataataacatagtgcatttgtctaatcactcattttat
ggacttttcaatgtgagacaccttaatttgaaacgatcttttcctaaacaaagtgtgtcc
ctcacttcacttcccaagattgatgatttttcctttcagtggctaagatgcttggagtac
cttaacatggaagataatgatattccaagcataaaaagaaatatgttcacaggattgata
aacttgagatacttaagtctatccaactccttcacaaatttgagaactttaaaaaatgaa
acattttcatcactagctcattcccccttactcatactcaacctgaccaaaaataaaatc
tcaaaaatagagagtgatgcgttctcctggttgggctccctagaggtgcttgacattgga
attaatgaaattgggcaagaactcacaggacaggaatggagaggtctagaaaatattttt
gaaatctacctttcctacaacaaatacctacaactcactagcaactcctttgccctggtc
ccaagccttcaaagactgatgctccgaagggtggctcttaaaaatgtggatatctcccct
tcacctttccaccctcttcatgacttgaccattctggatttaagcaacaacaacctagcc
aacataaatgaagaaatgctagagggccttgaaaagctagaagttttggatttgcagcac
aacaatttggcacgactctggaaacaagcaaaccccggtggtcctgtccatttcctcaag
ggtctttcccaccttcacacccttaacttagagtctaatggcttggatgagatcccagaa
ggagttttcaagaatttatttcaactaaaaagcatcaacttagccttgaataatttaaat
gtacttccacaatctgtctttgatgaccaggtatctctgaagtcattgaaccttcaaaag
aatctcataacatcagttgaaaagaaagtttttgggccagttttcaagaatctgagtaat
ttagatatgagctttaacccatttgactgtacatgtgaaagtattgcctggtttgttaat
tggattaataagacacgtaccaacatctctgagttatcaagtcattacctctgcaatact
ccacctcagtatcatgggttctcagtgaggctttttgatacatcatcctgcaaagacagt
gcaccctttgaactccttttcatgatcaataccagtttcctgttattgtttatctttatt
gtgctgctcatccattttgagggctggaggatatctttttattggaatgtttcagtacat
cgaattctcggtttcaaagaaatagatggccagccagagcagtttgaatacacagcatat
ataattcatgcatacaaagatagggactgggtctgggaacacttttcctcaatggaggaa
gaagatccatctatcaaattttgtctagaagaaagggactttcaggcaggtgtccttgga
cttgaagccattgtcaatagcatcaaaaggagcaggaaaattatttttgttataacacag
catcttctaaaggacccattatgcaaaagattcaaggtacaccatgcagttcagcaagct
atcgaacaaaacttggattcaattatattgatttttctagagaatattccagattataaa
ctgaaccacgcactctgtttacgaagaggaatgtttaaatctcgttgcattttctattgg
ccagttcataaagaacggatagaggcttttcatcataaattgcaagtagcacttggatct
agaaattcactacattaa

DBGET integrated database retrieval system