KEGG   Oryctolagus cuniculus (rabbit): 100009028
Entry
100009028         CDS       T03373                                 

Gene name
KITLG, Kitl
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04916  Melanogenesis
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009028 (KITLG)
   04014 Ras signaling pathway
    100009028 (KITLG)
   04015 Rap1 signaling pathway
    100009028 (KITLG)
   04072 Phospholipase D signaling pathway
    100009028 (KITLG)
   04151 PI3K-Akt signaling pathway
    100009028 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100009028 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    100009028 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009028 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009028 (KITLG)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   100009028 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 100009028
NCBI-ProteinID: NP_001075692
Ensembl: ENSOCUG00000017687
UniProt: Q2I093
LinkDB
Position
4
AA seq 273 aa
MKKTQTWIITCIYLQLLLFNPLVKTKGICGNLVTDNVKDITKLVANLPKDYMITLNYVPG
MDILPSHCWIHEMVIQLSVSLTNLLDKFSNISEGLSNYSIIDKLGKIVDDLVECVEENSP
KNVKASSKRPEPRPFTPEQFFRIFNRSIDAFKDFVVVSETSDCVLPSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNSKAESSIADSSLQWAAMALPAFFSLVIGFAFGALYWKKK
QPNLTRAVENIQSNEEDNEISMLQEKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctcttgtcaaaacgaaagggatctgcgggaatcttgtgactgataatgtaaaagacatc
acaaaattggtggcaaatcttccaaaagactatatgataaccctcaactatgtccccggg
atggacattttgccaagtcattgttggatacatgagatggtgatacagttgtcagtcagc
ttgactaatcttctggataagttttcaaatatttctgaaggcttgagtaattattctatc
atagacaaacttgggaaaatagtggatgaccttgtggagtgtgtggaagaaaactcacct
aagaatgtaaaagcatcctccaagaggccagaacccagaccctttactcctgaacaattc
tttagaatttttaatagatccatcgatgccttcaaggactttgtggtggtatctgaaact
agtgattgtgtgcttccttcaacgttaagtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aatagcaaggctgaaagttccattgcagactccagcctacagtgggcagccatggcgttg
ccagcattcttttctcttgtaattggctttgcttttggagccttatactggaagaagaaa
caaccaaatcttacaagggcagttgaaaatatacagagtaatgaagaggataatgagata
agtatgttgcaagaaaaagagagagaatttcaagaagtgtaa

DBGET integrated database retrieval system