KEGG   Oryctolagus cuniculus (rabbit): 100009037
Entry
100009037         CDS       T03373                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04012  ErbB signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04151  PI3K-Akt signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04934  Cushing syndrome
ocu05162  Measles
ocu05165  Human papillomavirus infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05203  Viral carcinogenesis
ocu05206  MicroRNAs in cancer
ocu05215  Prostate cancer
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100009037 (CDKN1B)
   04066 HIF-1 signaling pathway
    100009037 (CDKN1B)
   04068 FoxO signaling pathway
    100009037 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    100009037 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100009037 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009037 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    100009037 (CDKN1B)
   05206 MicroRNAs in cancer
    100009037 (CDKN1B)
   05203 Viral carcinogenesis
    100009037 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100009037 (CDKN1B)
   05220 Chronic myeloid leukemia
    100009037 (CDKN1B)
   05215 Prostate cancer
    100009037 (CDKN1B)
   05222 Small cell lung cancer
    100009037 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100009037 (CDKN1B)
   04934 Cushing syndrome
    100009037 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    100009037 (CDKN1B)
   05169 Epstein-Barr virus infection
    100009037 (CDKN1B)
   05165 Human papillomavirus infection
    100009037 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100009037 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100009037
NCBI-ProteinID: XP_002712708
Ensembl: ENSOCUG00000013974
UniProt: G1T6H1
LinkDB
Position
8
AA seq 198 aa
MSNVRVSNGSPSLERTDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVDKGSLPEFYYRPPRPPKGACKVPAQESQDTGGVRPAAPVAA
SQASSEDTHLGDPKTEQSDGPTALAEQCAGMRKRPATDDSSPQNKRANRTEENGSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtccaacgtgcgcgtgtccaacgggagcccaagcctggagcgcacggacgccaggcag
gcggagcaccccaagccctccgcctgcagaaacctcttcggcccggtgaatcacgaagag
ctgactcgggacctggagaagcactgcagagacatggaggaggcgagccagcgcaagtgg
aatttcgacttccagaatcacaagcccctggagggcaagtacgaatggcaggaggtggat
aagggcagcttgcccgagttctattacagacccccgcggccgcccaagggcgcctgcaag
gtgccggcgcaggaaagccaggacaccggcggggtccgccccgcggcgccggtggccgcg
tcccaggccagctccgaggacacgcacctgggggacccaaagactgagcagtccgacggc
cccacggccttggccgagcagtgcgcggggatgaggaagcgacctgccacagacgattct
tcccctcaaaacaaaagagccaacagaacagaagaaaacggttccgacggttccccgaac
gccggctctgtggagcagacgcccaagaagccgggcctccgaagacgtcagacgtaa

DBGET integrated database retrieval system