KEGG   Oryctolagus cuniculus (rabbit): 100009038
Entry
100009038         CDS       T03373                                 

Gene name
CCND3
Definition
(RefSeq) cyclin D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04510  Focal adhesion
ocu04630  JAK-STAT signaling pathway
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100009038 (CCND3)
   04390 Hippo signaling pathway
    100009038 (CCND3)
   04630 JAK-STAT signaling pathway
    100009038 (CCND3)
   04151 PI3K-Akt signaling pathway
    100009038 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100009038 (CCND3)
   04115 p53 signaling pathway
    100009038 (CCND3)
   04218 Cellular senescence
    100009038 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100009038 (CCND3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009038 (CCND3)
   05203 Viral carcinogenesis
    100009038 (CCND3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009038 (CCND3)
   05162 Measles
    100009038 (CCND3)
   05164 Influenza A
    100009038 (CCND3)
   05169 Epstein-Barr virus infection
    100009038 (CCND3)
   05165 Human papillomavirus infection
    100009038 (CCND3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 100009038
NCBI-ProteinID: XP_008261133
LinkDB
Position
12
AA seq 424 aa
MRAPPGGALVALPPPRGWPPAPPRRSRGPPPPPPCAPLPRRAAGCDLHVYEHSAPGRLPG
SAPRAPAPARAPPPAPILCPALISAEQRSRHSGCWGVLWKLQSPGACTALSARQRTGGRS
PARTQHPAAGPAMEHQLLCSEVEAVRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCV
QKEILPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMF
LASKLKETIPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKL
PQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSIGAAVQGLGACSTSGDELTEL
LAGITGTEVDCLRACQEQIEAALRESLREASQTTSNPAPKAPRGSSSQGPSQTSTPTDVT
AIHL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcgagcgcctcccgggggtgccctcgtggcgctgccccctccacgcgggtggccgccc
gccccaccccgccggtctcgggggccacccccgcccccgccctgcgccccgcttccccgg
cgggcggcggggtgcgatttgcatgtctatgagcactcggctccgggacggctcccgggc
tcggcccctcgcgcgcccgcccccgcgcgcgccccgccccccgcccccattctctgcccg
gctttgatctccgctgaacagcggtcgcgtcactcgggctgctggggagttttgtggaag
ttgcaaagtcccggcgcctgcacagcgctgtcggcgcggcagcggacgggcggccggagc
ccagcgcgcacccagcaccccgccgccgggccggccatggagcaccagctcctgtgctcc
gaggtggaggccgtgcgccgcgcctaccccgacgccaacctgctcaacgaccgggtgctg
cgcgccatgctcaaggcggaggagacctgcgcgccctccgtgtcctacttcaagtgcgtg
cagaaggagatcctgccgtccatgcgcaagatcgtggccacctggatgctggaggtctgc
gaggagcagaagtgcgaggaggaggtcttcccgctggccatgaactacctggaccgcttc
ctggccggggtgccgactcccaagacccatctgcagctgctgggggccgtgtgcatgttt
ctggcctccaagctgaaagagaccatcccgctgacggccgagaagctgtgcatctacacg
gacaactccatcaagccccaggagctgctggagtgggagctggtggtgctggggaagttg
aagtggaacctggccgccgtcacccctcacgacttcatcgagcacatcctgcgcaagctg
ccgcagcagagggagaagctgtctctgatccgcaagcacgcgcagaccttcattgctctc
tgcgccaccgacttcaagttcgccatgtacccgccgtccatgatcgcaacaggcagcatt
ggggccgcagtgcaaggcctgggtgcctgctccacatccggcgatgagctcactgagctg
ctggcagggatcacaggcactgaagtggactgcctgcgtgcctgtcaggagcagattgaa
gctgcactcagggagagcctcagggaagcttcccagaccacctccaacccagcacccaaa
gccccccggggctccagcagccaggggcccagccagaccagcactcccacagatgtcaca
gccatccacctgtag

DBGET integrated database retrieval system