KEGG   Oryctolagus cuniculus (rabbit): 100009039
Entry
100009039         CDS       T03373                                 

Gene name
CDK4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04218  Cellular senescence
ocu04530  Tight junction
ocu04660  T cell receptor signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04934  Cushing syndrome
ocu05160  Hepatitis C
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05212  Pancreatic cancer
ocu05214  Glioma
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100009039 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100009039 (CDK4)
   04115 p53 signaling pathway
    100009039 (CDK4)
   04218 Cellular senescence
    100009039 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100009039 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100009039 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009039 (CDK4)
   05203 Viral carcinogenesis
    100009039 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100009039 (CDK4)
   05225 Hepatocellular carcinoma
    100009039 (CDK4)
   05214 Glioma
    100009039 (CDK4)
   05220 Chronic myeloid leukemia
    100009039 (CDK4)
   05218 Melanoma
    100009039 (CDK4)
   05219 Bladder cancer
    100009039 (CDK4)
   05224 Breast cancer
    100009039 (CDK4)
   05222 Small cell lung cancer
    100009039 (CDK4)
   05223 Non-small cell lung cancer
    100009039 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100009039 (CDK4)
   04934 Cushing syndrome
    100009039 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009039 (CDK4)
   05162 Measles
    100009039 (CDK4)
   05164 Influenza A
    100009039 (CDK4)
   05160 Hepatitis C
    100009039 (CDK4)
   05163 Human cytomegalovirus infection
    100009039 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009039 (CDK4)
   05169 Epstein-Barr virus infection
    100009039 (CDK4)
   05165 Human papillomavirus infection
    100009039 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100009039 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009039 (CDK4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100009039 (CDK4)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100009039 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 100009039
NCBI-ProteinID: XP_002720970
LinkDB
Position
Un
AA seq 303 aa
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSSGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSAGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRAAFSPRGPRPVQSVVPELEESGAQLLLEMLTFSPHKRISACRALQHSYLHKEEG
GPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacctctcgctacgagcctgtagctgaaattggtgtcggtgcctacgggacggtg
tacaaggcccgggacccccacagtggccactttgtggccctcaagagcgtgcgagtcccc
aatggaggaggcgctggagggggccttcccatcagcactgttcgcgaggtggctttactc
aggcggctggaggcctttgagcaccccaatgttgtccggctgatggacgtctgtgccacc
tcccgaaccgaccgggaaatcaaggtgaccctggtgtttgagcacgtcgaccaagaccta
aggacgtatctggacaaggcacccccaccaggcctgccggcagagaccatcaaggatctg
atgcgccagtttcttagaggcctggatttccttcatgccaattgcatcgtccaccgagac
ctgaagccagagaatattctggtgacgagcagcgggacggtcaagctggctgacttcggc
ctggctagaatctacagctaccagatggcgcttacacctgtggttgtgacgctctggtac
cgtgctcctgaggttcttctgcagtctacatatgccacgcctgtggacatgtggagcgct
ggctgtatctttgcagaaatgtttcgtcgaaagcctctcttctgtggaaactccgaagcc
gaccagctgggcaaaatctttgacctgatcgggctgcctccggaagacgactggccccga
gatgtgtcgctcccccgagcggccttctccccaagagggccccgcccagtgcagtcggtg
gtgccggagctggaggagtccggagcgcagctgctgctggaaatgctgactttcagccca
cacaagcggatctctgcctgcagagccctgcagcactcttacctccacaaggaagaaggc
ggcccagagtga

KEGG   Oryctolagus cuniculus (rabbit): 100009040
Entry
100009040         CDS       T03373                                 

Gene name
CDK6
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04218  Cellular senescence
ocu04934  Cushing syndrome
ocu05160  Hepatitis C
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05206  MicroRNAs in cancer
ocu05212  Pancreatic cancer
ocu05214  Glioma
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100009040 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100009040 (CDK6)
   04115 p53 signaling pathway
    100009040 (CDK6)
   04218 Cellular senescence
    100009040 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009040 (CDK6)
   05206 MicroRNAs in cancer
    100009040 (CDK6)
   05203 Viral carcinogenesis
    100009040 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100009040 (CDK6)
   05225 Hepatocellular carcinoma
    100009040 (CDK6)
   05214 Glioma
    100009040 (CDK6)
   05220 Chronic myeloid leukemia
    100009040 (CDK6)
   05218 Melanoma
    100009040 (CDK6)
   05224 Breast cancer
    100009040 (CDK6)
   05222 Small cell lung cancer
    100009040 (CDK6)
   05223 Non-small cell lung cancer
    100009040 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100009040 (CDK6)
  09172 Infectious disease: viral
   05162 Measles
    100009040 (CDK6)
   05164 Influenza A
    100009040 (CDK6)
   05160 Hepatitis C
    100009040 (CDK6)
   05163 Human cytomegalovirus infection
    100009040 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009040 (CDK6)
   05169 Epstein-Barr virus infection
    100009040 (CDK6)
   05165 Human papillomavirus infection
    100009040 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009040 (CDK6)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100009040 (CDK6)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100009040 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 100009040
NCBI-ProteinID: XP_002713851
Ensembl: ENSOCUG00000011078
UniProt: G1T0K2
LinkDB
Position
10
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALAHPYF
QDLERGKESLDPHLPPSQSASELNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgcgccgaccagcagtacgagtgcgtggcggagatcggg
gagggcgcctacgggaaggtgttcaaggcccgcgacctcaagaacggaggccggttcgtg
gcgctgaagcgcgtgcgggtgcagacgggcgaggaaggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggctgttc
gatgtatgcacagtgtcccggacagacagagagacaaagctaacactagtgtttgaacat
gttgatcaagacttgaccacttacctggataaagttccggagcctggagtgcccactgaa
actataaaggatatgatgtttcagctcctgcgaggtctggactttcttcattctcaccga
gtagtgcatcgtgatctaaaaccacagaacattctggtgaccagcagtggacaaataaaa
ctggctgacttcggccttgcgcgcatctacagttttcagatggctcttacttcagtggtc
gtcacgctgtggtaccgagctccagaagtcctgctgcagtccagctacgccacgcccgtg
gatctctggagtgtcggctgcatatttgcagaaatgtttcgtagaaagcctctctttcgt
ggaagttcagatgtggatcagctaggaaaaatcttggacgtcattggactcccaggagaa
gaggactggcccagagatgttgcccttcccaggcaagcgtttcattccaaatctgcccag
ccgattgagaagttcgtaacagatatcgatgaactaggcaaagacctgcttctgaagtgc
ttgaccttcaatccagccaaaagaatatctgcctacagcgccctggcccacccgtacttc
caagacctggagaggggcaaggagagcttggatccccacctaccgcccagccagagcgcc
tcagagctgaacacagcctga

DBGET integrated database retrieval system