Oryctolagus cuniculus (rabbit): 100009068 Help Entry 100009068         CDS       T03373                                  Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu04010   MAPK signaling pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04020   Calcium signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04810   Regulation of actin cytoskeleton ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05207   Chemical carcinogenesis - receptor activation ocu05218   Melanoma ocu05224   Breast cancer ocu05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100009068    04014 Ras signaling pathway     100009068    04015 Rap1 signaling pathway     100009068    04020 Calcium signaling pathway     100009068    04151 PI3K-Akt signaling pathway     100009068  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100009068   09142 Cell motility    04810 Regulation of actin cytoskeleton     100009068  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100009068    05205 Proteoglycans in cancer     100009068    05207 Chemical carcinogenesis - receptor activation     100009068   09162 Cancer: specific types    05226 Gastric cancer     100009068    05218 Melanoma     100009068    05224 Breast cancer     100009068   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     100009068   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100009068  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100009068    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100009068 Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Growth factors (RTK binding)    100009068 Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    100009068 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  100009068 NCBI-ProteinID:  XP_002717284 UniProt:  G1SDD5 LinkDB All DBs Position 15:95520328..95610308 Genome browser AA seq 155 aa AA seqDB search MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcagccgggagcatcaccacgctgccagccctgccggaggatggaggcagcggcgcc ttcccgcccggccacttcaaggaccccaagcggctgtactgcaaaaacgggggtttcttc ctgcgtatccaccccgacggccgcgtggacggggtccgggagaagagcgacccacacatc aaattacaacttcaagcagaagagagaggagttgtatccatcaaaggtgtgtgtgcaaac cgttaccttgctatgaaggaagatggaagactgctggcttctaaatgtgttacagacgag tgcttcttttttgaacgactggagtctaataactacaatacttaccggtcaaggaaatat tccagctggtatgtggcactgaaacgaactgggcagtataaacttggatccaaaacagga cctgggcagaaggctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system