KEGG   Oryctolagus cuniculus (rabbit): 100009088
Entry
100009088         CDS       T03373                                 

Gene name
TNF, TNFA, TNFSF2, TNLG1F
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01523  Antifolate resistance
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04064  NF-kappa B signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04150  mTOR signaling pathway
ocu04210  Apoptosis
ocu04217  Necroptosis
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04612  Antigen processing and presentation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04650  Natural killer cell mediated cytotoxicity
ocu04657  IL-17 signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04668  TNF signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04940  Type I diabetes mellitus
ocu05010  Alzheimer disease
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05205  Proteoglycans in cancer
ocu05310  Asthma
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009088 (TNF)
   04350 TGF-beta signaling pathway
    100009088 (TNF)
   04064 NF-kappa B signaling pathway
    100009088 (TNF)
   04668 TNF signaling pathway
    100009088 (TNF)
   04071 Sphingolipid signaling pathway
    100009088 (TNF)
   04150 mTOR signaling pathway
    100009088 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009088 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100009088 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100009088 (TNF)
   04217 Necroptosis
    100009088 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100009088 (TNF)
   04620 Toll-like receptor signaling pathway
    100009088 (TNF)
   04621 NOD-like receptor signaling pathway
    100009088 (TNF)
   04622 RIG-I-like receptor signaling pathway
    100009088 (TNF)
   04625 C-type lectin receptor signaling pathway
    100009088 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    100009088 (TNF)
   04612 Antigen processing and presentation
    100009088 (TNF)
   04660 T cell receptor signaling pathway
    100009088 (TNF)
   04657 IL-17 signaling pathway
    100009088 (TNF)
   04664 Fc epsilon RI signaling pathway
    100009088 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100009088 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100009088 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100009088 (TNF)
  09163 Immune disease
   05310 Asthma
    100009088 (TNF)
   05322 Systemic lupus erythematosus
    100009088 (TNF)
   05323 Rheumatoid arthritis
    100009088 (TNF)
   05321 Inflammatory bowel disease
    100009088 (TNF)
   05330 Allograft rejection
    100009088 (TNF)
   05332 Graft-versus-host disease
    100009088 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009088 (TNF)
   05014 Amyotrophic lateral sclerosis
    100009088 (TNF)
   05020 Prion disease
    100009088 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    100009088 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100009088 (TNF)
   05410 Hypertrophic cardiomyopathy
    100009088 (TNF)
   05414 Dilated cardiomyopathy
    100009088 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100009088 (TNF)
   04940 Type I diabetes mellitus
    100009088 (TNF)
   04932 Non-alcoholic fatty liver disease
    100009088 (TNF)
   04931 Insulin resistance
    100009088 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100009088 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100009088 (TNF)
   05135 Yersinia infection
    100009088 (TNF)
   05133 Pertussis
    100009088 (TNF)
   05134 Legionellosis
    100009088 (TNF)
   05152 Tuberculosis
    100009088 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009088 (TNF)
   05170 Human immunodeficiency virus 1 infection
    100009088 (TNF)
   05164 Influenza A
    100009088 (TNF)
   05161 Hepatitis B
    100009088 (TNF)
   05160 Hepatitis C
    100009088 (TNF)
   05168 Herpes simplex virus 1 infection
    100009088 (TNF)
   05163 Human cytomegalovirus infection
    100009088 (TNF)
   05169 Epstein-Barr virus infection
    100009088 (TNF)
   05165 Human papillomavirus infection
    100009088 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100009088 (TNF)
   05144 Malaria
    100009088 (TNF)
   05145 Toxoplasmosis
    100009088 (TNF)
   05140 Leishmaniasis
    100009088 (TNF)
   05142 Chagas disease
    100009088 (TNF)
   05143 African trypanosomiasis
    100009088 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100009088 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009088 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009088 (TNF)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100009088 (TNF)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Haparin
  Cytokines
   100009088 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100009088
NCBI-ProteinID: NP_001075732
Ensembl: ENSOCUG00000006698
UniProt: P04924 A0A5S8H7U2
LinkDB
Position
12
AA seq 234 aa
MSTESMIRDVELAEGPLPKKAGGPQGSKRCLCLSLFSFLLVAGATTLFCLLHFRVIGPQE
EESPNNLHLVNPVAQMVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMK
LTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHR
ETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL
NT seq 705 nt   +upstreamnt  +downstreamnt
atgagcactgagagtatgatccgggacgtcgagctggcggaggggccgctccccaagaag
gcaggggggccccagggctccaagcgctgcctctgcctcagcctcttctctttcctgctc
gtggctggagccaccacgctcttctgcctgctgcacttcagggtgatcggccctcaggag
gaagagtccccaaacaacctccatctagtcaaccctgtggcccagatggtcaccctcaga
tcagcttctcgggccctgagtgacaagcctctagcccacgtagtagcaaacccgcaagtg
gagggccagctccagtggctgagccagcgtgcgaacgccctgctggccaacggcatgaag
ctcacggacaaccagctggtggtgccggccgacgggctgtacctcatctactcccaggtt
ctcttcagcggtcaaggctgccgctcctacgtgctcctcactcacactgtcagccgcttc
gccgtctcctacccgaacaaggtcaacctcctctctgccatcaagagcccctgccaccgg
gagacccccgaggaggctgagcccatggcctggtacgagcccatctacctgggcggcgtc
ttccagttggagaagggtgaccggctcagcaccgaggtcaaccagcctgagtacctggac
cttgccgagtccgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system