KEGG   Oryctolagus cuniculus (rabbit): 100009129
Entry
100009129         CDS       T03373                                 

Gene name
CXCL8, IL8
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04218  Cellular senescence
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05144  Malaria
ocu05146  Amoebiasis
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05219  Bladder cancer
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100009129 (CXCL8)
   04072 Phospholipase D signaling pathway
    100009129 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009129 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100009129 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100009129 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100009129 (CXCL8)
   04621 NOD-like receptor signaling pathway
    100009129 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    100009129 (CXCL8)
   04657 IL-17 signaling pathway
    100009129 (CXCL8)
   04062 Chemokine signaling pathway
    100009129 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009129 (CXCL8)
   05202 Transcriptional misregulation in cancer
    100009129 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    100009129 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009129 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100009129 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100009129 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100009129 (CXCL8)
   05135 Yersinia infection
    100009129 (CXCL8)
   05133 Pertussis
    100009129 (CXCL8)
   05134 Legionellosis
    100009129 (CXCL8)
  09172 Infectious disease: viral
   05164 Influenza A
    100009129 (CXCL8)
   05161 Hepatitis B
    100009129 (CXCL8)
   05163 Human cytomegalovirus infection
    100009129 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009129 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100009129 (CXCL8)
   05144 Malaria
    100009129 (CXCL8)
   05142 Chagas disease
    100009129 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009129 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009129 (CXCL8)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100009129 (CXCL8)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Haparin
  Chemokines
   100009129 (CXCL8)
SSDB
Motif
Pfam: IL8 DUF5527
Other DBs
NCBI-GeneID: 100009129
NCBI-ProteinID: NP_001075762
Ensembl: ENSOCUG00000011835
UniProt: P19874
LinkDB
Position
15
AA seq 101 aa
MNSKLAVALLATFLLSLTLCEAAVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPH
CANSEIIVKLVDGRELCLDPKEKWVQKVVQIFLKRAEQQES
NT seq 306 nt   +upstreamnt  +downstreamnt
atgaactccaagctggctgtggctctcttggcaaccttcctgctgtctctgactctttgt
gaagctgcagttctgacacggattggtacagagcttcgatgccagtgcataaagacacac
tccacacctttccatcccaaatttatcaaagaattgagagtgattgagagtggacctcac
tgtgcaaattcagaaatcattgtaaaacttgttgatggaagagaactctgcctggacccc
aaggaaaagtgggtgcagaaggttgtgcaaatattcttgaagagggctgagcagcaagag
tcataa

DBGET integrated database retrieval system