KEGG   Oryctolagus cuniculus (rabbit): 100009130
Entry
100009130         CDS       T03373                                 

Gene name
CCL2
Definition
(RefSeq) chemokine (C-C motif) ligand 2
  KO
K14624  C-C motif chemokine 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05144  Malaria
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05323  Rheumatoid arthritis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100009130 (CCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009130 (CCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100009130 (CCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100009130 (CCL2)
   04657 IL-17 signaling pathway
    100009130 (CCL2)
   04062 Chemokine signaling pathway
    100009130 (CCL2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009130 (CCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100009130 (CCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100009130 (CCL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100009130 (CCL2)
  09172 Infectious disease: viral
   05164 Influenza A
    100009130 (CCL2)
   05168 Herpes simplex virus 1 infection
    100009130 (CCL2)
   05163 Human cytomegalovirus infection
    100009130 (CCL2)
  09174 Infectious disease: parasitic
   05144 Malaria
    100009130 (CCL2)
   05142 Chagas disease
    100009130 (CCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009130 (CCL2)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009130 (CCL2)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100009130 (CCL2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Haparin
  Chemokines
   100009130 (CCL2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100009130
NCBI-ProteinID: NP_001075763
Ensembl: ENSOCUG00000021710
UniProt: P28292
LinkDB
Position
19
AA seq 125 aa
MKVSATLLCLLLIAVAFSSHVLAQPDAVNSPVTCCYTFTNKTISVKRLMSYRRINSTKCP
KEAVIFMTKLAKGICADPKQKWVQDAIANLDKKMQTPKTLTSYSTTQEHTTNLSSTRTPS
TTTSL
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaaggtctctgcaacgcttctgtgcctgctgctcatagcagtcgccttcagctcccat
gtgcttgcccagccagatgccgtgaattccccagtcacctgctgctatacattcaccaac
aagaccatctcagtgaagaggctaatgagctatagaagaatcaacagcaccaagtgtccc
aaagaagctgtgatcttcatgaccaaactggccaaggggatctgtgctgaccccaagcag
aagtgggtccaggatgccattgccaacctggacaagaaaatgcagacaccaaagactttg
acctcttattccacaacccaagaacacacgactaatttatcttccacccggacaccctct
actactacttcattgtaa

DBGET integrated database retrieval system