KEGG   Oryctolagus cuniculus (rabbit): 100009248Help
Entry
100009248         CDS       T03373                                 

Gene name
PTGS2, COX-2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00590  Arachidonic acid metabolism
ocu01100  Metabolic pathways
ocu04064  NF-kappa B signaling pathway
ocu04370  VEGF signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04723  Retrograde endocannabinoid signaling
ocu04726  Serotonergic synapse
ocu04913  Ovarian steroidogenesis
ocu04921  Oxytocin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu05140  Leishmaniasis
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05200  Pathways in cancer
ocu05204  Chemical carcinogenesis
ocu05206  MicroRNAs in cancer
ocu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100009248 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100009248 (PTGS2)
   04064 NF-kappa B signaling pathway
    100009248 (PTGS2)
   04668 TNF signaling pathway
    100009248 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100009248 (PTGS2)
   04657 IL-17 signaling pathway
    100009248 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100009248 (PTGS2)
   04913 Ovarian steroidogenesis
    100009248 (PTGS2)
   04921 Oxytocin signaling pathway
    100009248 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    100009248 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100009248 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100009248 (PTGS2)
   05206 MicroRNAs in cancer
    100009248 (PTGS2)
   05204 Chemical carcinogenesis
    100009248 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    100009248 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    100009248 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009248 (PTGS2)
   05165 Human papillomavirus infection
    100009248 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    100009248 (PTGS2)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100009248 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 100009248
NCBI-ProteinID: NP_001075857
Ensembl: ENSOCUG00000016771
UniProt: O02768
LinkDB All DBs
Position
16
AA seq 604 aa AA seqDB search
MLARALLLCAAVALSHAANPCCSNPCQNRGVCMTMGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLLLKPTPDTVHYILTHFKGVWNIVNSIPFLRNSIMKYVLTSRSHMIDSPPTYNVHY
NYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKDVVEKLLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDLKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QVIDGEVYPPTVKDTQVEMIYPPHIPAHLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIDDQQYNYQQFLYNNSILLEHGLTQFVESFTRQIAGRV
AGGRNVPPAVQKVAKASIDQSRQMKYQSLNEYRKRFLLKPYESFEELTGEKEMAAELEAL
YGDIDAVELYPALLVERPRPDAIFGESMVEMGAPFSLKGLMGNPICSPNYWKPSTFGGEV
GFKIVNTASIQSLICNNVKGCPFTSFNVPDPQLTKTVTINASASHSRLEDINPTVLLKGR
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctctgcgccgcggtggcgctcagccacgcagcaaatcct
tgctgttccaacccatgtcaaaaccgaggtgtgtgcatgaccatgggatttgaccagtac
aagtgcgactgcacccggaccggattctacggtgaaaactgctccacgccggaatttctg
accagaatcaaactgctcctgaaacccactccggacacggtgcactacatccttacgcac
ttcaagggagtctggaacatcgtcaatagcattcctttcctgcgaaattcaatcatgaaa
tacgtgctgacatccagatcacatatgattgacagtccaccaacatataatgtgcactac
aactacaagagctgggaagccttctctaacctctcctactacacaagagccctcccccct
gtggccgatgactgcccaacgcccatgggtgtgaaaggcaagaaagaacttcctgactct
aaagacgtggtggagaaacttctcctcagaagaaagttcatccccgacccccagggcacc
aacatgatgtttgcattctttgcccagcacttcacccaccagttcttcaagacagatctt
aagcggggaccagccttcaccaaaggactgggacatggggtggacttaaatcatatttac
ggtgaaactctggacagacagcataaactgcgcctcttcaaggatggaaaaatgaaatat
caggtaattgatggagaggtatatcctccaacagtcaaggacacgcaggtggagatgatc
tacccgcctcacatccctgcgcacctgcagtttgctgtgggccaggaagtgtttggtctg
gtgcctggtttgatgatgtatgccacaatctggctccgggaacataacagagtgtgcgat
gtgctcaaacaggagcatccagaatgggatgatgagcagctattccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagactatgtacagcatttgagtggc
tatcacttcaaactcaagtttgacccagagctgcttttcaaccaacaattccagtaccaa
aaccggattgctgctgagtttaacacactctatcactggcatccccttctgcctgacacc
tttcaaattgatgaccagcagtacaactatcaacagtttctctacaacaactctatacta
ctggaacatggacttacccagtttgttgaatcattcaccaggcaaattgctggcagggtc
gccggtggcaggaacgttccgcctgcggtgcagaaagtagcaaaggcctccattgaccag
agcaggcagatgaaataccagtctcttaacgagtaccgcaaacgctttttgctgaagccc
tatgaatcgttcgaggaacttacaggggagaaggagatggctgccgagctggaagcgctc
tacggcgacattgatgccgtggaactgtatcctgccctgctggtggagagaccgcgcccg
gatgccatctttggggagtccatggtagaaatgggagcaccgttctccttaaaaggactg
atgggtaatcctatatgttctcctaactactggaagccaagcacgtttggtggagaagtc
ggtttcaaaatcgttaacactgcctcgattcagtccctcatctgcaacaatgtgaagggc
tgtcccttcacttcattcaacgtcccagatcctcagctcaccaaaacagtcaccatcaac
gcgagcgcctcccactcccggctagaggacatcaatcccacagtcctgctgaaaggccgc
tccactgaactgtag

DBGET integrated database retrieval system