KEGG   Oryctolagus cuniculus (rabbit): 100009255
Entry
100009255         CDS       T03373                                 

Gene name
WAP
Definition
(RefSeq) whey acidic protein
  KO
K17106  whey acidic protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100009255 (WAP)
SSDB
Motif
Pfam: WAP
Other DBs
NCBI-GeneID: 100009255
NCBI-ProteinID: NP_001075859
Ensembl: ENSOCUG00000022314
UniProt: P09412
LinkDB
Position
10
AA seq 127 aa
MRCLISLALGLLALEAALALAPKFIAPVQVMCPEPSSSEETLCLSDNDCLGSTVCCPSAA
GGSCRTPIIVPTPKAGRCPWVQAPMLSQLCEELSDCANDIECRGDKKCCFSRCAMRYLEP
ILESTPQ
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcgctgtctcatcagcctggccctcggcctgctcgccctggaggcggccctcgctctg
gcccccaagttcatcgctccagtgcaggtcatgtgccccgagcccagctcttccgaggag
acgctctgcctcagtgacaacgactgtctcggcagcaccgtgtgctgtcccagcgccgcc
ggcggctcctgcagaacccccatcatcgtccctacccccaaggctggccgctgcccctgg
gtgcaggcgccaatgctgtcccagttgtgtgaggagctgagcgactgtgccaacgacatc
gagtgcaggggcgacaagaagtgctgcttcagccgctgcgccatgcgctatctggaaccc
atcctagagagcactccccagtga

DBGET integrated database retrieval system