KEGG   Oryctolagus cuniculus (rabbit): 100009260
Entry
100009260         CDS       T03373                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase B1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04012  ErbB signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04350  TGF-beta signaling pathway
ocu04371  Apelin signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04714  Thermogenesis
ocu04910  Insulin signaling pathway
ocu04931  Insulin resistance
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05221  Acute myeloid leukemia
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100009260 (RPS6KB1)
   04350 TGF-beta signaling pathway
    100009260 (RPS6KB1)
   04371 Apelin signaling pathway
    100009260 (RPS6KB1)
   04066 HIF-1 signaling pathway
    100009260 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    100009260 (RPS6KB1)
   04152 AMPK signaling pathway
    100009260 (RPS6KB1)
   04150 mTOR signaling pathway
    100009260 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100009260 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100009260 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100009260 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    100009260 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    100009260 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100009260 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009260 (RPS6KB1)
   05205 Proteoglycans in cancer
    100009260 (RPS6KB1)
   05231 Choline metabolism in cancer
    100009260 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100009260 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100009260 (RPS6KB1)
   05212 Pancreatic cancer
    100009260 (RPS6KB1)
   05225 Hepatocellular carcinoma
    100009260 (RPS6KB1)
   05226 Gastric cancer
    100009260 (RPS6KB1)
   05221 Acute myeloid leukemia
    100009260 (RPS6KB1)
   05224 Breast cancer
    100009260 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100009260 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100009260 (RPS6KB1)
   05163 Human cytomegalovirus infection
    100009260 (RPS6KB1)
   05165 Human papillomavirus infection
    100009260 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100009260 (RPS6KB1)
   01522 Endocrine resistance
    100009260 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009260 (RPS6KB1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100009260 (RPS6KB1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100009260 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100009260
NCBI-ProteinID: NP_001095160
Ensembl: ENSOCUG00000004600
UniProt: P67998
LinkDB
Position
19
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTTSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgcctgacttccgagacagggaa
gctgaggacatggctggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatacgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacggaaagtaacaggagcaaatactgggaaaatattt
gctatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaggatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagtggaggagaatta
tttatgcagttagaaagagagggaatatttatggaagatacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatccattcatgatggaacagtcacacacacattttgcggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgccgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaacgctgcttcacgtcttggagctggtcct
ggggatgctggagaagttcaagctcacccattcttcagacacattaattgggaagaactt
ctagctcgaaaggtggagccgccctttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtcttcttgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacggacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacggcaaatcctcagacacctgtggaatacccaatggaaacaagtgga
atagagcagatggatgtgacgacaagtggggaagcatcagctccacttccgatacgacag
ccgaactccggaccatacaaaaaacaagcttttcccatgatctccaaacggccagagcac
ctgcgtatgaatctatga

DBGET integrated database retrieval system