KEGG   Oryctolagus cuniculus (rabbit): 100009272
Entry
100009272         CDS       T03373                                 

Gene name
ACTB, ACT-5
Definition
(RefSeq) actin beta
  KO
K05692  actin beta/gamma 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04145  Phagosome
ocu04210  Apoptosis
ocu04390  Hippo signaling pathway
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04670  Leukocyte transendothelial migration
ocu04714  Thermogenesis
ocu04810  Regulation of actin cytoskeleton
ocu04919  Thyroid hormone signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04971  Gastric acid secretion
ocu05014  Amyotrophic lateral sclerosis
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05164  Influenza A
ocu05205  Proteoglycans in cancer
ocu05225  Hepatocellular carcinoma
ocu05410  Hypertrophic cardiomyopathy
ocu05412  Arrhythmogenic right ventricular cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05416  Viral myocarditis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100009272 (ACTB)
   04390 Hippo signaling pathway
    100009272 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100009272 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    100009272 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100009272 (ACTB)
   04520 Adherens junction
    100009272 (ACTB)
   04530 Tight junction
    100009272 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100009272 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100009272 (ACTB)
   04670 Leukocyte transendothelial migration
    100009272 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100009272 (ACTB)
   04919 Thyroid hormone signaling pathway
    100009272 (ACTB)
  09154 Digestive system
   04971 Gastric acid secretion
    100009272 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    100009272 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100009272 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100009272 (ACTB)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100009272 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100009272 (ACTB)
   05410 Hypertrophic cardiomyopathy
    100009272 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100009272 (ACTB)
   05414 Dilated cardiomyopathy
    100009272 (ACTB)
   05416 Viral myocarditis
    100009272 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100009272 (ACTB)
   05135 Yersinia infection
    100009272 (ACTB)
   05100 Bacterial invasion of epithelial cells
    100009272 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    100009272 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ocu03021]
    100009272 (ACTB)
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100009272 (ACTB)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100009272 (ACTB)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100009272 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100009272 (ACTB)
   04147 Exosome [BR:ocu04147]
    100009272 (ACTB)
Transcription machinery [BR:ocu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100009272 (ACTB)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100009272 (ACTB)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100009272 (ACTB)
    NuA4 complex
     100009272 (ACTB)
  Chromatin remodeling factors
   BAF complex
    100009272 (ACTB)
   PBAF complex
    100009272 (ACTB)
   SWR1 complex
    100009272 (ACTB)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100009272 (ACTB)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100009272 (ACTB)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100009272 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100009272
NCBI-ProteinID: NP_001095153
Ensembl: ENSOCUG00000005867
UniProt: P29751
LinkDB
Position
Un
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEERPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgacgatatcgccgcgctcgtggtcgacaatggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgccccccgggccgtcttcccctccatcgtggggcgtccgcggcac
cagggcgtgatggtgggcatgggccagaaggactcgtacgtgggcgacgaggcccagagc
aagcgtggcatcctgacgctcaagtacccgatcgagcacggcatcgtgaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagcttcgcgtggcgcccgaggaa
cgcccggtgctgctgaccgaggcccccctgaaccccaaggccaaccgcgagaagatgacc
cagatcatgttcgagacgttcaacacgccggccatgtacgtggccatccaggccgtgctg
tccctgtacgcctctggccgcaccacgggcatcgtgatggactctggcgacggggtcacc
cacacggtgcccatctacgagggctacgcgctgccgcacgccatcctgcgtctggacctg
gccggccgggacctgaccgactacctcatgaagatcctcacggagcgcggctacagcttc
accaccacggccgagcgcgagatcgtgcgggacatcaaggagaagctgtgctacgtggcg
ctggacttcgagcaggagatggccacggccgcgtcctcctcctccctggagaagagctac
gagctgcccgacggccaggtcatcaccatcggcaacgagcgcttccgttgccccgaggcg
ctcttccagccctccttcctgggcatggagtcgtgtggcatccacgagaccaccttcaac
tcgatcatgaagtgcgacgtggacatccgcaaggacctgtacgccaacacggtgctgtcg
ggcggcaccaccatgtaccccggcatcgccgaccgcatgcagaaggagatcaccgccctg
gcgcccagcaccatgaagatcaagatcatcgcgcccccggagcgcaagtactcggtgtgg
atcggcggctccatcctggcctcgctctccaccttccagcagatgtggatcagcaagcag
gagtatgacgagtcgggcccctccatcgtgcaccgcaagtgcttctag

DBGET integrated database retrieval system