KEGG   Oryctolagus cuniculus (rabbit): 100009274Help
Entry
100009274         CDS       T03373                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04614  Renin-angiotensin system
ocu04924  Renin secretion
ocu05142  Chagas disease (American trypanosomiasis)
ocu05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    100009274 (ACE)
   04614 Renin-angiotensin system
    100009274 (ACE)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100009274 (ACE)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100009274 (ACE)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100009274 (ACE)
Peptidases [BR:ocu01002]
 Metallo Peptidases
  Family M2
   100009274 (ACE)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100009274 (ACE)
CD molecules [BR:ocu04090]
 Proteins
  100009274 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100009274
NCBI-ProteinID: NP_001075864
Ensembl: ENSOCUG00000001555
UniProt: P12822
LinkDB All DBs
Position
19
AA seq 1310 aa AA seqDB search
MGAAPGRRGPRLLRPPPPLLLLLLLLRPPPAALTLDPGLLPGDFAADEAGARLFASSYNS
SAEQVLFRSTAASWAHDTNITAENARRQEEEALLSQEFAEAWGKKAKELYDPVWQNFTDP
ELRRIIGAVRTLGPANLPLAKRQQYNSLLSNMSQIYSTGKVCFPNKTASCWSLDPDLNNI
LASSRSYAMLLFAWEGWHNAVGIPLKPLYQEFTALSNEAYRQDGFSDTGAYWRSWYDSPT
FEEDLERIYHQLEPLYLNLHAYVRRVLHRRYGDRYINLRGPIPAHLLGNMWAQSWESIYD
MVVPFPDKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEKPEDGR
EVVCHASAWDFYNRKDFRIKQCTQVTMDQLSTVHHEMGHVQYYLQYKDQPVSLRRANPGF
HEAIGDVLALSVSTPAHLHKIGLLDHVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRW
GVFSGRTPSSRYNFDWWYLRTKYQGICPPVVRNETHFDAGAKFHIPSVTPYIRYFVSFVL
QFQFHQALCMEAGHQGPLHQCDIYQSTRAGAKLRAVLQAGCSRPWQEVLKDMVASDALDA
QPLLDYFQPVTQWLQEQNERNGEVLGWPEYQWRPPLPNNYPEGIDLVTDEAEASRFVEEY
DRSFQAVWNEYAEANWNYNTNITTEASKILLQKNMQIANHTLTYGNWARRFDVSNFQNAT
SKRIIKKVQDLQRAVLPVKELEEYNQILLDMETIYSVANVCRVDGSCLQLEPDLTNLMAT
SRKYDELLWVWTSWRDKVGRAILPYFPKYVEFTNKAARLNGYVDAGDSWRSMYETPTLEQ
DLERLFQELQPLYLNLHAYVGRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVA
PFPSASTMDATEAMIKQGWTPRRMFEEADKFFISLGLLPVPPEFWNKSMLEKPTDGREVV
CHASAWDFYNGKDFRIKQCTTVNMEDLVVVHHEMGHIQYFMQYKDLPVALREGANPGFHE
AIGDVLALSVSTPKHLHSINLLSSEGGGYEHDINFLMKMALDKIAFIPFSYLVDEWRWRV
FDGSITKENYNQEWWSLRLKYQGLCPPAPRSQGDFDPGAKFHIPSSVPYIRYFVSFIIQF
QFHEALCKAAGHTGPLHTCDIYQSKEAGKRLADAMKLGYSKPWPEAMKVITGQPNMSASA
MMNYFKPLMDWLLTENGRHGEKLGWPQYTWTPNSARSEGSLPDSGRVNFLGMNLDAQQAR
VGQWVLLFLGVALLLASLGLTQRLFSIRYQSLRQPHHGPQFGSEVELRHS
NT seq 3933 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgccgggccgccgggggccgaggctgctgcggccgccgccgccgctgctg
ctgctgctcctgctgctgcggccgccgcccgccgccctgacgctggaccctgggctgctg
cccggcgactttgccgccgacgaggccggcgcgcggctcttcgcgagcagctacaactcg
agcgccgagcaggttctgtttcggagcaccgcagccagctgggcgcacgacaccaacatc
accgcggagaacgcaaggcgccaggaggaagaagccctgctcagccaagagtttgcagag
gcctggggcaagaaggctaaggagctctatgacccggtgtggcagaacttcaccgaccca
gagctgcgcaggatcatcggggctgtgcgcaccctgggccctgccaacctgcccctggcc
aagcggcagcagtacaactctctgctgagcaacatgagccaaatctactccacgggcaag
gtctgcttccccaacaagactgccagctgctggtccctggacccagacctcaacaacatc
ctggcttcctcacggagctacgccatgctgctgtttgcctgggagggctggcacaatgcc
gtgggcatcccattgaagcccctctaccaggaattcaccgcgctcagcaacgaggcctac
cggcaggatggcttctcggacacgggggcctactggcgctcctggtatgactcgcccacc
ttcgaggaggacctggagcgcatctaccatcagttagagcccctctacctgaacctgcac
gcctatgtccggcgagtgctccaccgccgctacggggacagatacatcaacctcagggga
cccatccccgcacacctgctggggaacatgtgggcccagagctgggaaagcatctacgac
atggtggtgccctttccagacaagcccaacctggatgtcaccagcaccatggtgcagaag
ggctggaatgctacacacatgttccgggtggccgaggagttcttcacctccctggggctc
ttacccatgcctcctgaattctgggctgagtcgatgctggagaagccggaggatgggcgg
gaggtggtgtgccacgcctcggcctgggacttctacaaccggaaggacttcaggattaag
cagtgcacgcaggtgacgatggaccagctgtccacggtgcaccatgagatgggccacgtg
cagtactacctccagtacaaagaccaacctgtctccctgcgccgagccaaccccggcttc
cacgaggccatcggcgacgtgctagcgctgtcagtctccacgcctgcacatctgcacaaa
atcggtctcctggaccacgtcaccaatgacacagaaagtgacatcaattacttgctgaag
atggcactggaaaaaatcgccttcctgccctttggctatttggtggaccagtggcgctgg
ggggtcttcagtgggcggacgccctcttcccgctacaactttgactggtggtatcttcgc
accaagtatcagggcatctgccctcccgtcgtgagaaatgagacccactttgatgccgga
gctaagttccatatcccaagtgtgacgccgtacatcaggtactttgtgagctttgtcctg
cagttccagttccatcaagccctgtgcatggaggccggccaccagggtccactgcaccag
tgtgacatctaccagtccacccgcgcaggggccaagctccgggcggtgctgcaggcaggc
tgctccaggccctggcaggaggtgctcaaggacatggtcgcctccgacgccctggacgcc
cagccgctgctcgactacttccagccagtcacccagtggctgcaggagcagaacgagcgc
aatggcgaggtcctgggctggccggagtatcagtggcgcccaccgctgcccaacaactac
ccggaaggcatcgacctggtgaccgatgaggctgaggccagccggttcgtggaggagtat
gaccggtcgttccaggcagtgtggaatgagtacgcggaggccaactggaactataacacc
aacatcaccacagaggccagcaagatcctgctgcagaaaaacatgcagatagccaaccac
accctcacgtacggcaactgggccaggaggtttgatgtgagcaacttccagaacgccacc
agcaagcgcatcataaagaaggttcaggacctgcagcgggcagtgctgcccgtcaaggag
ctggaggagtacaaccagatcctgctggacatggagaccatttacagcgtggccaacgtg
tgccgcgtggacggctcttgtctccagctggagcctgatctgaccaatctgatggccacg
tctcggaaatacgacgaactgttgtgggtgtggacaagctggcgggacaaggtggggaga
gccatcctcccgtattttccgaaatatgtggagttcaccaacaaggctgcccggctcaat
ggctacgttgatgcaggggactcctggaggtccatgtacgagacgccgaccctggagcaa
gacctggagcggctcttccaggagctgcagccgctctacctgaacctgcacgcctacgtc
ggccgcgccctgcaccgccactacggagcccagcacatcaacctggagggccccattcct
gcacacctgctggggaacatgtgggcgcagacctggtccaacatctatgacctggtggct
cctttcccttcagcctccacgatggatgccacagaggccatgatcaagcagggctggact
cccaggagaatgtttgaggaagctgacaagttcttcatctccctggggctgctgcccgtg
cctcccgagttctggaacaagtcgatgctggagaagcccaccgacgggcgggaggtggtg
tgccacgcctcggcctgggacttctacaatggcaaggatttcaggatcaagcagtgcacc
acggtgaacatggaggacctggtggtggtccaccacgagatgggtcacatccagtacttc
atgcagtacaaggacttgcccgtggccttgcgggagggcgccaaccccggctttcacgag
gccatcggggacgtgctggccctctcggtgtccacgcccaagcacttacacagcatcaac
ctgctgagcagcgagggcggcggctacgagcacgacatcaacttcctcatgaagatggca
ctcgacaagatcgcctttatccccttcagctacctcgtggacgagtggcgctggagggta
tttgacgggagcattaccaaggagaactacaaccaggagtggtggagcctcaggctgaag
taccagggcctctgtcccccggcgcctaggtctcaaggtgactttgatccaggggccaag
ttccacatcccttcaagtgtgccttacatcaggtactttgtcagcttcatcatccagttc
cagttccacgaggcactgtgcaaggcagctggccacactggccccttgcacacctgtgac
atctaccagtccaaggaggcagggaagcgcctggcggatgccatgaagctgggctacagt
aagccgtggccagaagccatgaaggtgattacaggccagcccaacatgtcagcctcggcc
atgatgaactacttcaagccgctgatggactggctcctcaccgagaacgggcggcacggg
gagaagctgggctggccgcagtacacctggactccaaactctgctcgctcggaaggctcc
ctcccagactccggccgcgtcaacttcctgggcatgaacctggacgcgcagcaggcccgc
gtgggccagtgggtgctgctcttcctgggcgtcgccttgctcttggccagcttgggcctc
acccagcggctcttcagtatccgctaccagagcctccgccagccccaccacgggccccag
ttcggctccgaggtggagctaagacactcctga

DBGET integrated database retrieval system