KEGG   Oryctolagus cuniculus (rabbit): 100009292
Entry
100009292         CDS       T03373                                 

Gene name
TP53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04010  MAPK signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04137  Mitophagy - animal
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04211  Longevity regulating pathway
ocu04216  Ferroptosis
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009292 (TP53)
   04310 Wnt signaling pathway
    100009292 (TP53)
   04071 Sphingolipid signaling pathway
    100009292 (TP53)
   04151 PI3K-Akt signaling pathway
    100009292 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100009292 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    100009292 (TP53)
   04210 Apoptosis
    100009292 (TP53)
   04216 Ferroptosis
    100009292 (TP53)
   04115 p53 signaling pathway
    100009292 (TP53)
   04218 Cellular senescence
    100009292 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100009292 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100009292 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    100009292 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009292 (TP53)
   05202 Transcriptional misregulation in cancer
    100009292 (TP53)
   05206 MicroRNAs in cancer
    100009292 (TP53)
   05205 Proteoglycans in cancer
    100009292 (TP53)
   05203 Viral carcinogenesis
    100009292 (TP53)
   05230 Central carbon metabolism in cancer
    100009292 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100009292 (TP53)
   05212 Pancreatic cancer
    100009292 (TP53)
   05225 Hepatocellular carcinoma
    100009292 (TP53)
   05226 Gastric cancer
    100009292 (TP53)
   05214 Glioma
    100009292 (TP53)
   05216 Thyroid cancer
    100009292 (TP53)
   05220 Chronic myeloid leukemia
    100009292 (TP53)
   05217 Basal cell carcinoma
    100009292 (TP53)
   05218 Melanoma
    100009292 (TP53)
   05219 Bladder cancer
    100009292 (TP53)
   05215 Prostate cancer
    100009292 (TP53)
   05213 Endometrial cancer
    100009292 (TP53)
   05224 Breast cancer
    100009292 (TP53)
   05222 Small cell lung cancer
    100009292 (TP53)
   05223 Non-small cell lung cancer
    100009292 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100009292 (TP53)
   05014 Amyotrophic lateral sclerosis
    100009292 (TP53)
   05016 Huntington disease
    100009292 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100009292 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009292 (TP53)
   05161 Hepatitis B
    100009292 (TP53)
   05160 Hepatitis C
    100009292 (TP53)
   05162 Measles
    100009292 (TP53)
   05168 Herpes simplex virus 1 infection
    100009292 (TP53)
   05163 Human cytomegalovirus infection
    100009292 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009292 (TP53)
   05169 Epstein-Barr virus infection
    100009292 (TP53)
   05165 Human papillomavirus infection
    100009292 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100009292 (TP53)
   01522 Endocrine resistance
    100009292 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100009292 (TP53)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100009292 (TP53)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100009292 (TP53)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100009292 (TP53)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100009292 (TP53)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100009292 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD DEC-1_N
Other DBs
NCBI-GeneID: 100009292
NCBI-ProteinID: NP_001075873
Ensembl: ENSOCUG00000001138
UniProt: Q95330
LinkDB
Position
19
AA seq 391 aa
MEESQSDLSLEPPLSQETFSDLWKLLPENNLLTTSLNPPVDDLLSAEDVANWLNEDPEEG
LRVPAAPAPEAPAPAAPALAAPAPATSWPLSSSVPSQKTYHGNYGFRLGFLHSGTAKSVT
CTYSPCLNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCS
DSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCM
GGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCPELPPGS
SKRALPTTTTDSSPQTKKKPLDGEYFILKIRGRERFEMFRELNEALELKDAQAEKEPGGS
RAHSSYLKAKKGQSTSRHKKPMFKREGPDSD
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggaggagtcgcagtcggatctcagcctcgagcctcccctgagtcaggagacgttttca
gacctgtggaaactgcttcctgagaacaacctgctgaccacctcgctgaaccctcccgtg
gatgatctgctgtctgcagaagacgttgcaaactggctcaacgaagacccagaagaaggg
ctccgagtaccagcagctcctgcaccagaggcccccgccccagctgcccctgcgctggcg
gcccctgcaccagccacctcctggcccctgtcatcctctgtcccttcccaaaagacctac
catggcaactacggtttccggctgggcttcctgcactctgggacggccaagtctgtcacc
tgcacatactccccctgcctcaacaagctgttctgccagctagcaaagacctgccctgtg
cagctgtgggtcgactcgacgcccccgcctggcacccgcgtccgggccatggccatctac
aagaagtctcagcacatgacggaagttgtcagacgctgcccccaccacgagcgctgctcc
gacagcgatggtctggccccccctcagcatctcatccgggtggagggaaatctccgtgcg
gagtatttggatgacagaaacaccttccgacacagcgtggtggtgccctacgagccgccc
gaggttggctctgactgtaccaccatccactataattacatgtgtaacagctcctgcatg
gggggcatgaaccggcggcccatcctcaccatcatcacactggaagactccagtgggaac
ctgctgggacggaacagctttgaggtgcgagtgtgtgcctgtcctgggagggaccgccgc
acggaggaagaaaatttccgcaagaaaggggagccctgccctgaactgccccctgggagc
tctaagcgagcactgccgaccaccaccaccgactcctctccccagacaaagaagaagccg
ctggatggagaatatttcatccttaagatccgcgggcgtgaacggttcgagatgttccga
gagctgaacgaggccctggagctaaaggatgcccaggccgagaaggagcccggggggagc
agggctcactccagctacctgaaggccaagaaggggcagtctacctcccgccataaaaaa
ccaatgttcaagagagaggggcctgactcagactga

DBGET integrated database retrieval system