KEGG   Oryctolagus cuniculus (rabbit): 100009298
Entry
100009298         CDS       T03373                                 

Gene name
PPP1CA, PPP1A
Definition
(RefSeq) protein phosphatase 1 catalytic subunit alpha
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04114  Oocyte meiosis
ocu04218  Cellular senescence
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04390  Hippo signaling pathway
ocu04510  Focal adhesion
ocu04611  Platelet activation
ocu04720  Long-term potentiation
ocu04728  Dopaminergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04931  Insulin resistance
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05168  Herpes simplex virus 1 infection
ocu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100009298 (PPP1CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100009298 (PPP1CA)
   04024 cAMP signaling pathway
    100009298 (PPP1CA)
   04022 cGMP-PKG signaling pathway
    100009298 (PPP1CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100009298 (PPP1CA)
   04218 Cellular senescence
    100009298 (PPP1CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100009298 (PPP1CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100009298 (PPP1CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100009298 (PPP1CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100009298 (PPP1CA)
   04921 Oxytocin signaling pathway
    100009298 (PPP1CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100009298 (PPP1CA)
   04270 Vascular smooth muscle contraction
    100009298 (PPP1CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    100009298 (PPP1CA)
   04720 Long-term potentiation
    100009298 (PPP1CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100009298 (PPP1CA)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100009298 (PPP1CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100009298 (PPP1CA)
   05034 Alcoholism
    100009298 (PPP1CA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100009298 (PPP1CA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100009298 (PPP1CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100009298 (PPP1CA)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ocu03021]
    100009298 (PPP1CA)
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100009298 (PPP1CA)
   03041 Spliceosome [BR:ocu03041]
    100009298 (PPP1CA)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100009298 (PPP1CA)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100009298 (PPP1CA)
Transcription machinery [BR:ocu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100009298 (PPP1CA)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100009298 (PPP1CA)
Spliceosome [BR:ocu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100009298 (PPP1CA)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 100009298
NCBI-ProteinID: NP_001095176
Ensembl: ENSOCUG00000027936
UniProt: P62139
LinkDB
Structure
PDB: 
1FJM

Position
13
AA seq 311 aa
MVTIMTTSEYLSGYEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYG
GFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDE
CKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQG
LLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFA
KRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQLSGLNPGGRPI
TPPRNSAKAKK
NT seq 936 nt   +upstreamnt  +downstreamnt
atggttacaataatgacaaccagtgaatatttatcaggatacgagatccgtggtctgtgc
ctcaaatcccgggagatcttcctgagccagcccattctgctggagctggaggcgcccctc
aagatctgcggtgacatccacggccagtactacgacctgctgcggctgttcgagtacggc
ggcttccccccggagagcaactacctgttcctgggtgactacgtggaccgcggcaagcag
tccctggagaccatctgcctgctgctggcctacaagatcaagtaccccgagaacttcttc
ctgctgcgcgggaaccacgagtgcgccagcatcaaccgcatctacggcttctacgacgag
tgcaagagacgctacaacatcaagctgtggaagacgttcaccgactgcttcaactgcctg
cccatcgcggccattgtggacgagaagatattctgctgccatggcggcctctcccccgac
ctgcagtccatggagcagatccggcgcatcatgcggcccacggacgtgcccgaccagggc
ctgctgtgtgacctgctgtggtctgaccccgacaaggacgtgcagggctggggcgagaac
gaccgcggcgtctccttcaccttcggcgcggaggtggtggccaagttcctgcacaagcat
gacctggacctcatctgccgggcgcaccaggtggtggaggacggctatgagttctttgcc
aagcggcagctggtgacacttttctcagcccccaactactgtggcgagttcgacaacgcc
ggagccatgatgagcgtggacgagaccctcatgtgctccttccagatccttaagccggcc
gacaagaacaagggcaagtacgggcagttaagtggcctgaaccctggaggccgacccatc
accccaccccgcaactctgccaaagccaagaaatag

KEGG   Oryctolagus cuniculus (rabbit): 100009587
Entry
100009587         CDS       T03373                                 

Gene name
PPP1CB, PP1-BETA
Definition
(RefSeq) protein phosphatase 1 catalytic subunit beta
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04114  Oocyte meiosis
ocu04218  Cellular senescence
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04390  Hippo signaling pathway
ocu04510  Focal adhesion
ocu04611  Platelet activation
ocu04720  Long-term potentiation
ocu04728  Dopaminergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04931  Insulin resistance
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05168  Herpes simplex virus 1 infection
ocu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100009587 (PPP1CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100009587 (PPP1CB)
   04024 cAMP signaling pathway
    100009587 (PPP1CB)
   04022 cGMP-PKG signaling pathway
    100009587 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100009587 (PPP1CB)
   04218 Cellular senescence
    100009587 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100009587 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100009587 (PPP1CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100009587 (PPP1CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100009587 (PPP1CB)
   04921 Oxytocin signaling pathway
    100009587 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100009587 (PPP1CB)
   04270 Vascular smooth muscle contraction
    100009587 (PPP1CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    100009587 (PPP1CB)
   04720 Long-term potentiation
    100009587 (PPP1CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100009587 (PPP1CB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100009587 (PPP1CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100009587 (PPP1CB)
   05034 Alcoholism
    100009587 (PPP1CB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100009587 (PPP1CB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100009587 (PPP1CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100009587 (PPP1CB)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ocu03021]
    100009587 (PPP1CB)
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100009587 (PPP1CB)
   03041 Spliceosome [BR:ocu03041]
    100009587 (PPP1CB)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100009587 (PPP1CB)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100009587 (PPP1CB)
Transcription machinery [BR:ocu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100009587 (PPP1CB)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100009587 (PPP1CB)
Spliceosome [BR:ocu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100009587 (PPP1CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 100009587
NCBI-ProteinID: NP_001095192
Ensembl: ENSOCUG00000001023
UniProt: P62143
LinkDB
Position
2
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggacagcctcatcacccgcctgctggaggtacgagga
tgtcgtccaggaaagattgtgcaaatgactgaagcggaagtgcggggcctttgtatcaag
tctcgggagatcttcctcagccagcctattctcttggaattggaagcaccactgaaaatt
tgtggagatattcatggacagtatacagatttactgagattatttgagtatggaggtttc
ccaccagaagccaactatcttttcttaggagattatgtggatagaggaaaacagtctttg
gaaaccatttgtttgctattggcttacaaaatcaaatatccagagaacttctttctctta
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattctatgatgaatgcaag
cgaaggtttaatattaaattgtggaagaccttcactgactgctttaactgtctgcctata
gctgccattgtggatgagaagatcttctgttgtcatggaggactgtcaccagacctacaa
tctatggagcagattcggagaattatgagacccactgatgtccctgatacaggtttgctc
tgtgatttactgtggtctgacccagacaaggacgtgcaaggctggggagaaaatgaccgt
ggtgtttccttcacttttggcgctgatgtagtcagtaaatttctgaatcgtcatgattta
gacctgatttgtcgagctcatcaggtggtggaagatggatatgaattttttgctaagcga
caattggtaaccctattttcagccccaaattactgtggcgagtttgataatgctggtgga
atgatgagtgtggatgagactttgatgtgttcatttcagatattgaaaccatctgaaaag
aaagctaaataccagtatggtggactgaattctggacgccctgtcactccacctcgaaca
gctaatccaccgaagaaaaggtga

KEGG   Oryctolagus cuniculus (rabbit): 100353054
Entry
100353054         CDS       T03373                                 

Gene name
PPP1CC
Definition
(RefSeq) protein phosphatase 1 catalytic subunit gamma
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04114  Oocyte meiosis
ocu04218  Cellular senescence
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04390  Hippo signaling pathway
ocu04510  Focal adhesion
ocu04611  Platelet activation
ocu04720  Long-term potentiation
ocu04728  Dopaminergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04931  Insulin resistance
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05168  Herpes simplex virus 1 infection
ocu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100353054 (PPP1CC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100353054 (PPP1CC)
   04024 cAMP signaling pathway
    100353054 (PPP1CC)
   04022 cGMP-PKG signaling pathway
    100353054 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100353054 (PPP1CC)
   04218 Cellular senescence
    100353054 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100353054 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100353054 (PPP1CC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100353054 (PPP1CC)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100353054 (PPP1CC)
   04921 Oxytocin signaling pathway
    100353054 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100353054 (PPP1CC)
   04270 Vascular smooth muscle contraction
    100353054 (PPP1CC)
  09156 Nervous system
   04728 Dopaminergic synapse
    100353054 (PPP1CC)
   04720 Long-term potentiation
    100353054 (PPP1CC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100353054 (PPP1CC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100353054 (PPP1CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    100353054 (PPP1CC)
   05034 Alcoholism
    100353054 (PPP1CC)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100353054 (PPP1CC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100353054 (PPP1CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100353054 (PPP1CC)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ocu03021]
    100353054 (PPP1CC)
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100353054 (PPP1CC)
   03041 Spliceosome [BR:ocu03041]
    100353054 (PPP1CC)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100353054 (PPP1CC)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100353054 (PPP1CC)
Transcription machinery [BR:ocu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100353054 (PPP1CC)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100353054 (PPP1CC)
Spliceosome [BR:ocu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100353054 (PPP1CC)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 100353054
NCBI-ProteinID: XP_002719795
Ensembl: ENSOCUG00000009275
UniProt: G1SWW8
LinkDB
Position
21
AA seq 337 aa
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRVPSGLNPSIQKASNYRNNTVLYE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcggatatagacaaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgttcagctacaggagaatgaaatcagaggactgtgctta
aagtctcgagagatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgacatccatggacaatactatgatctgctgcgactctttgagtacggtggc
ttcccgccagagagcaactacctgttcctgggggactacgtggacaggggaaagcagtcg
ctggagacgatctgcctcttactggcctacaagatcaaataccccgagaatttttttctt
ctcagagggaaccatgaatgtgccagcatcaataggatttacggattttatgatgaatgt
aaaagaagatacaacattaaactatggaaaactttcacagactgttttaactgtttaccg
atagcagccatcgtggatgagaaaatcttctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtgccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggcgtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccaccaggtggttgaagatggatatgagttttttgcaaag
aggcagttggtcactctgttttctgcacccaactattgtggagagtttgacaatgcaggt
gccatgatgagtgtggacgaaacactaatgtgttcctttcagattttgaagcctgcagag
aaaaagaagccgaacgccacgagacctgtgacacctccacgggttccatcaggcctgaac
ccgtccattcagaaagcttcaaattataggaacaatactgtcctatacgagtga

DBGET integrated database retrieval system