KEGG   Oryctolagus cuniculus (rabbit): 100009347Help
Entry
100009347         CDS       T03373                                 

Gene name
BMI1
Definition
(RefSeq) BMI1 proto-oncogene, polycomb ring finger
  KO
K11459  polycomb group RING finger protein 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu05202  Transcriptional misregulation in cancer
ocu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100009347 (BMI1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100009347 (BMI1)
   05206 MicroRNAs in cancer
    100009347 (BMI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100009347 (BMI1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     100009347 (BMI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 Prok-RING_4 zf-RING_UBOX zf-C3HC4_4 zf-RING_10 zf-Nse
Motif
Other DBs
NCBI-GeneID: 100009347
NCBI-ProteinID: XP_008266499
Ensembl: ENSOCUG00000005420
UniProt: G1SNW4
LinkDB All DBs
Position
16
AA seq 326 aa AA seqDB search
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
DKRIITDDEIISLSIEFFDQNRLDRKVSKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR
DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPTTPVQSPHPQFPHISSTMNGTSNSP
SGNHQSSFANRPRKSSVNGSSATSSG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgaacaaccagaatcaagatcactgagctaaatccccacctaatgtgtgtgctt
tgtggaggatacttcattgatgccaccaccataatagaatgtctacattccttctgtaaa
acatgtattgtgcgttacctggagaccagcaagtattgccctatttgtgatgttcaagtt
cacaaaaccaggccactgctgaatataaggtcagataaaactcttcaagatatcgtatac
aaattagttccagggcttttcaaaaatgaaatgaagagaagaagggatttttatgcagct
catccttcagctgatgctgccaatggctctaatgaagatagaggagaagttgcagatgaa
gataagagaattataactgatgatgaaataataagtttatccattgaattctttgaccag
aacagattggatcggaaagtaagcaaagacaaagagaaatctaaggaggaggtgaatgat
aaaagatatttacgatgcccagcagcaatgactgtgatgcacttaagaaagtttctcaga
agtaaaatggacatacctaacactttccagattgatgtcatgtatgaagaggagcccttg
aaggattactatacactaatggatattgcctacatttatacctggagaaggaatggtcca
cttcctttgaaatacagagttcgacctacttgtaagaggatgaagatcagtcatcagaga
gatggactgacaaatgctggagaactggaaagtgactctgggagtgacaaggccaacagc
ccagcaggaggtattccctccacctcttcttgtttgcctagccccactactccagtgcag
tctcctcatccacagtttcctcacatttctagtactatgaatggaaccagcaacagcccc
agcggtaaccaccaatcttcttttgccaatagacctcgaaaatcatcagtaaatgggtcg
tcagcaacttcatctggttga

DBGET integrated database retrieval system