KEGG   Oryctolagus cuniculus (rabbit): 100009373
Entry
100009373         CDS       T03373                                 

Gene name
ETS1, c-ets-1, c-ets1
Definition
(RefSeq) ETS proto-oncogene 1, transcription factor
  KO
K02678  C-ets-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04218  Cellular senescence
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100009373 (ETS1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100009373 (ETS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009373 (ETS1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100009373 (ETS1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009373 (ETS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100009373 (ETS1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100009373 (ETS1)
SSDB
Motif
Pfam: Ets SAM_PNT HSF_DNA-bind
Other DBs
NCBI-GeneID: 100009373
NCBI-ProteinID: NP_001076130
UniProt: Q6Q428
LinkDB
Position
1
AA seq 441 aa
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFAKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF
VGDILWEHLEILQKEDVKPYQVNGVNPTYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDPLQTDYFAIKQEVVTPDNMCMGR
TSRGKLGGQDSFESVESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDADE
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaaggcggccgtggatctcaagccgactctcaccatcatcaagacagaaaaggtcgac
ctggagcttttcccctcccccgatatggaatgtgcagatgtcccactgctgactcccagt
agcaaagaaatgatgtctcaggccttgaaagctacgttcagtggttttgctaaagagcag
caaagactgggaatcccgaaagacccccggcagtggacagaaacccacgtgcgtgactgg
gtgatgtgggcggtgaatgagttcagcctgaaaggcgtggacttccagaagttctgtatg
aatggagcagccctctgcgccctgggtaaagactgctttcttgagctggccccagacttt
gtgggggacatcctgtgggagcacctggagatcctgcagaaagaggacgtgaaaccgtat
caagtgaatggagtcaaccctacctatccagaatcccgctacacctcggattacttcatt
agctacggtatcgagcacgcccagtgcgtccctccgtcggagttctcggagccgagcttc
atcacagagtcctaccagaccctgcatcccatcagctcggaggaactgctgtctctcaag
tatgagaacgactacccctcggtcatcctgcgcgaccccctccagaccgaccccttgcag
accgactactttgccatcaagcaagaagtcgtgaccccagacaacatgtgcatggggcgg
accagtcgtggtaagctcgggggccaggactcttttgagagcgtagagagctacgatagt
tgcgatcggctcacacagtcctggagcagccagtcgtctttcaacagcctgcagcgcgtg
ccctcctatgacagcttcgactccgaggactatccggccgccctgcccaaccacaagccc
aagggcactttcaaggactatgtgcgtgaccgcgctgacctcaacaaggacaagcctgtc
attcctgctgctgccctggctggctacacaggcagtggaccaatccagctgtggcagttt
cttctggaattactcactgataaatcctgtcagtcctttatcagctggacaggagatggc
tgggagttcaagctttcggacccagatgaggtggccaggagatggggaaagaggaaaaac
aagccgaagatgaactatgagaaactgagccgtggcctacgctactattacgacaaaaac
atcatccacaagacagcgggtaaacgctatgtctaccgcttcgtctgtgacctgcagagc
ctgctgggttatacccccgaggagctccacgccatgctggatgtcaagccagatgccgat
gagtga

DBGET integrated database retrieval system