KEGG   Oryctolagus cuniculus (rabbit): 100009403
Entry
100009403         CDS       T03373                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04020  Calcium signaling pathway
ocu04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009403 (CACNA1E)
   04020 Calcium signaling pathway
    100009403 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100009403 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ocu04040]
    100009403 (CACNA1E)
Ion channels [BR:ocu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100009403 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 100009403
NCBI-ProteinID: NP_001095186
Ensembl: ENSOCUG00000017547
UniProt: Q02343
LinkDB
Position
Un
AA seq 2259 aa
MARFGEAAAGRPASGEGDSDQGRNLPGTPVPASGSAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFVNNSGVLEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKERLLRISVRHAVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAVYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNVPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPMEGLALGL
EKCEEEHVSRGGSLKGALDCQRSPLSLGRREPPWLARPCHGNCEPALQETAGGETVVTFE
DRARHRQSQRRSRHRRVRTEAKESSSASRSRSVSQERSLDEGASTEGERDHEARGSHGGK
EPTIHEEERAQDLRRTDSLMVPKGSGLAGGLDEAGTPLVLSSPEGVGKEAAPTEQHADGS
GEPALLGHVQLDVGRAISQSEPDLSCVTATTDKVTTESTDVTVAIPDAEPLVDSTVVHIG
NKTDGEASPFQEAEMKEAEQETEKQKKKERPASGKAMVPHSSMFIFSTSNPIRRACHYVV
NLRYFEMCILLVIAASSIALAAEDPVLTNSERNRVLRYFDYVFTGVFTFEMVIKMIDQGL
ILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIK
RLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECI
GNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRG
PSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFA
ISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELAL
KYLNIAFTMVFSLECVLKVIAFGFVNYFRDTWNIFDFITVIGSITEIVLTDSKLVNTTGF
NMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFG
NIRLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQQE
SERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAE
YDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLM
ALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYA
AMMIMDYYKQSKVKKQRRQLEEQKNAPMFQRMEPSSLPQEIIANAKALPCLPQGPPAGLG
GRSGCPAMSPLSPQIFQLTCMDPADDDGQFQEQRSLVVTDPGSMRRSFSTIRDKRSSSSW
LEEFSMERSSDNTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKEREHLL
SADVSRCSSEERGAQADWDSPERHPSRSPSEGRSQSPSRQGTGSLSESSIPSVSDTSTPR
HSRRQLPPVPPKPRPLLSYSSLKQQPSNFSPPADGSQGGSLLASPALESAQVGLPESSDS
PRRAQGSHASPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLR
HSWQMPNGHYRRRRRGGPGAGALCGAVGDLLSDTEEDKC
NT seq 6780 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggcggccggcaggcctgcctcaggcgagggagattcggac
cagggcaggaacctgccaggaacgcccgtgccggcctcggggtccgcggccgcctacaag
cagtcgaaggcgcagagggcgcgcaccatggccctgtacaaccccattcccgtccggcag
aactgcttcacggtgaacagatccctgttcatctttggagaagacaacattgtcaggaag
tacgccaagaagctcatcgactggccgccgttcgagtacatgatcctggccaccatcatc
gccaactgcatcgtcttggccctggagcagcacctgcctgaggacgacaagaccccaatg
tcccgccgactggagaagacagagccctacttcattgggatcttctgctttgaggctgga
atcaagatcgtggccctggggttcatcttccacaagggctcctacctccgcaatggctgg
aacgtcatggacttcatcgtggtcctcagtggcatcctggccacggcggggacccacttc
aacacgcacgtggacctgaggaccctgcgcgccgtgcgtgttttgcggcccttgaagctg
gtgtccggcatccccagcctgcagatcgtgctcaagtccatcatgaaggccatggtgccc
ctgctgcagatcggcctcctgctcttcttcgccatcctcatgtttgccatcatcggcctc
gagttctacagcgggaagctgcaccgtgcctgttttgtgaacaattcaggtgttctggaa
ggatttgacccccctcacccgtgtggcgtgcagggctgtccggccggttacgagtgcaag
gactggatcggccccaacgacgggatcacgcagttcgacaacatcctcttcgcggtgctc
accgtcttccagtgcatcaccatggagggctggacaaccgtgctgtacaataccaatgat
gccttaggagccacctggaactggctgtacttcatccccctcatcatcatcggatccttc
tttgtgctcaacctggtcctgggagtgctctccggggagtttgccaaagagagagagcga
gtggagaaccgcagagccttcatgaagctgcggcgtcagcagcagatcgagcgcgagctg
aacggctaccgggcctggatagacaaagcagaggaagtcatgcttgctgaggaaaacaaa
aactcggggacgtcagccttggaagtgctccgcagggcaaccatcaagcggagccgcacg
gaggccatgacccgtgactccagtgatgagcactgtgtcgacatttcttctgtgggcact
cctctcgcccgagccagcatcaagagcgccaaggtggacggggcctcctatttccggcac
aaggaacggctcctgcgcatctccgtgcgccatgcagtcaagtcccaggtgttttactgg
atcgtactgagcctcgtggctctcaacacagcctgcgtggccatcgtccaccacaaccag
ccccagtggctcacccacctcctctactacgcagagttcctgttcctgggcctgttcctc
ctggagatgtccctgaagatgtacggcatgggcccacgcctctacttccactcctccttc
aattgcttcgacttcggggttacagtgggcagcatcttcgaagtggtctgggcgatcttc
aggcctggcacatcttttggaatcagcgtcttgagagccctgcggcttctgagaatattt
aaaataaccaagtactgggcctccctgcggaatctggtcgtctccctgatgagctccatg
aagtccatcatcagcctgctcttcctcctcttcctcttcatcgtggtctttgctctcctt
ggcatgcagctgtttggaggcaggtttaacttcaatgatgggacgccctcggccaatttc
gacaccttccctgccgccatcatgacagtgttccagatcctaaccggtgaggactggaat
gaggtcatgtacaacgggatccgctcccagggcggggtcagctcgggcatgtggtcagct
gtctacttcattgtgctcaccttgtttggaaactacacactgttgaatgtgttcttggcc
atcgccgtggacaatctggccaatgcccaggagctgaccaaggatgagcaggaggaagag
gaggccttcaaccagaagcatgccctgcagaaggccaaggaggtcagcccaatgtctgca
cccaacgtgccctccatcgaaagagacaggaggagaagacaccacatgtcgatgtgggag
ccgcgcagcagccacctgagggagcgccggcgccggcaccacatgtcagtgtgggagcag
cggacaagccagctacggaggcacatgcagatgtccagccaggaagccctcaacaaggag
gaggcccccccgatgaaccccctcaacccgctcaaccccctgagccccctcaacccgctc
aacgcccaccccagcctctacaggagacccaggcccatggagggcctggccctgggcctg
gagaagtgtgaggaggagcatgtcagccgtggcgggtccctcaagggggccctggactgc
cagaggagccccttgtcgctgggcagacgggagccgccatggctggccaggccctgtcac
ggaaactgtgagccggcgctgcaggaaacagctgggggagagaccgtggtcaccttcgag
gaccgggccaggcacaggcagagccagcggcgcagccggcatcggcgagtccggacggaa
gccaaggaatcctcctcggcctcccggagcaggtctgtcagccaggagcggagcctggat
gagggggcgtcgacagagggcgagagagaccacgaagcccggggcagccatggcggcaaa
gaaccaacaatccacgaagaagagagagcccaggacttgcgcaggacagacagtctgatg
gtacccaaaggctcagggctggctggaggcctggatgaggccggcacacccctcgtcctg
tcctcacccgagggtgtggggaaagaggcagcacccacagagcagcatgcagatggcagc
ggtgagccggccctgctggggcacgtgcagctggacgtgggccgggccatcagccagagt
gagcccgacctctcctgcgtcacggccaccacagacaaggtcaccaccgagagcaccgat
gtcaccgtggccatccccgacgcggagcccctggtggattcaacggttgtgcacatcggc
aacaagacggatggagaagccagtcccttccaggaggctgagatgaaggaggccgagcag
gagacagaaaagcagaagaagaaggagaggccagcaagcggcaaagccatggtgccccac
agttccatgtttatcttcagcaccagcaacccgatccggagggcctgccactacgtggtg
aacctgcgctactttgagatgtgcatcctgctggtgatcgcggccagcagcatcgccctg
gcggctgaggacccggtgctgaccaactcggagcgcaacagagtcctgcgttatttcgac
tacgtgttcactggcgtgttcacctttgagatggtcatcaagatgatagaccagggcttg
atcctgcaggacgggtcctacttccgagacctgtggaacatcctggacttcgtggtggtg
gtcggtgcactggtggccttcgcgctggcgaatgctttggggaccaacaaggggcgcgac
atcaagaccatcaagtcgctgcgtgtgcttcgtgtgctgcggcccctgaagaccatcaag
cgcctgcccaagctgaaggccgtctttgactgcgtggtgacctccttgaagaacgtcttc
aacatcctcatcgtgtacaagctcttcatgttcatcttcgctgtcatcgcagtgcagctt
ttcaagggaaagttcttttactgcacggacagctccaaggacacggagaaggagtgcata
ggcaactatgtggatcatgagaaaaacaagatggaagtgaagggccgtgaatggaagcgc
cacgagttccactacgacaacatcatctgggctctgctgaccctcttcaccgtgtccacg
ggggaaggctggcctcaggttctgcagcactctgtggacgtgaccgaggaggaccgaggc
ccgagccgcagcaaccgcatggagatgtccatcttctacgtggtgtacttcgtggtcttc
cccttcttcttcgtcaacatctttgtggccctcatcatcatcactttccaagagcagggg
gacaagatgatggaggagtgcagcctggagaagaacgagagagcatgcatcgacttcgcc
atcagtgccaagccactcacccgctacatgccgcagaaccggcacacatttcagtaccgc
gtgtggcacttcgtggtgtccccatcctttgagtacaccatcatggccatgatcgccttg
aacaccgtcgtgctgatgatgaagtactactctgccccctgcacctacgagctggccctg
aagtacctgaacatcgccttcaccatggtgttctccctggagtgtgtcctgaaggtcatc
gcttttggcttcgtgaactatttccgtgacacctggaatatcttcgacttcatcactgtg
attggcagcatcacggagatcgtcctgactgacagcaagctggtgaacaccacgggcttc
aacatgagcttcctgaagctgttccgggccgcgcggctcatcaagctgctgcgccagggc
tacaccatccgcatcctgctctggaccttcgtgcagtccttcaaggccctgccctacgtc
tgcctgctgatcgccatgctcttcttcatttatgccatcatcgggatgcaggtcttcgga
aacatcagactagatgaagagagccacatcaaccggcacaacaacttccgcagtttcttc
gggtccctcatgttgctcttcaggagtgccacgggggaggcctggcaggagatcatgctg
tcgtgcctgggggagaagggctgtgagccggacaccaccgcgccctccggccagcaggag
agtgagcgctgcggcactgacctcgcctacgtctactttgtctccttcatcttcttctgc
tccttcctgatgctcaacctgttcgtagccgtcatcatggacaactttgagtacctgacg
cgggactcctccatcctggggccgcaccacctggacgagttcgtgcgtgtctgggcagag
tatgaccgggccgcatgtggccgcatccattacactgagatgtacgaaatgctgactctc
atgtcgccgccgctaggcctcggcaagagatgcccctccaaagtggcatataagaggttg
gtgctgatgaacatgccggtggctgaggacatgacggtccacttcacatccacgctcatg
gccctgatccgcacagccctggacatcaagattgccaaagggggtgcagaccggcaacag
ctggactcagagctgcagaaggagaccctggccatctggccccacctgtcccagaagatg
ctggacctgctggtgcccatgcccaaagcctctgacctgactgtgggcaaaatctacgcg
gcgatgatgatcatggactattacaaacagagcaaggtgaagaagcagaggcggcagctg
gaggagcagaaaaacgcacccatgttccagcgcatggagccctcctctctgccccaggaa
atcatcgccaacgccaaggccctgccctgcctcccgcagggcccccctgcaggcctgggt
ggccggagtggatgccctgcgatgagcccgctctccccacagatcttccagctgacctgc
atggacccggcagacgacgacgggcagttccaggagcagcgatctctggtggtgacagac
ccgggctcgatgagacgctccttctccaccatccgggataagcgctccagctcctcctgg
ctcgaggagttctccatggagaggagcagcgacaacacctacaagtcccggcgccgcagc
taccactcgtctctgcggctgtcggcgcaccgcctcaactcggactcgggtcacaagtct
gacacccaccgttctgggggcagagagcgggggcggtcaaaggagcgggaacatcttctg
tccgccgacgtgtcccgctgcagttctgaggaacgaggagcccaggcggactgggactcc
ccagagcgccatccatccaggtcccccagcgagggccggtcacagagccccagcagacag
ggcacgggttccctgagcgagagctccattccctccgtctcggacaccagcacccccaga
cacagccgccggcagctgccgcctgtcccgccgaagccacggccactcctctcctacagt
tccctgaagcagcagcccagcaacttctctccaccagccgacgggagccaggggggctcc
ctgctggcctccccggccctggagagcgcccaggtcggcctccctgagtcctctgactcc
ccgcgccgcgcccagggctcccatgcctccccccagcgctacatctcggagccctacctg
gcgctgcacgaggactcccacgcctcggactgcggcgaggaggagacgctcaccttcgag
gcagcagtggccaccagcctcggccgctccaacaccatcggctcagccccgcccctgcgg
cacagctggcagatgcccaatgggcactatcggcggcgccggcgtggggggcccggggcg
ggcgccctgtgtggcgctgtgggcgacctgctgagtgacactgaggaggacaagtgctag

DBGET integrated database retrieval system