KEGG   Oryctolagus cuniculus (rabbit): 100009414
Entry
100009414         CDS       T03373                                 

Gene name
SLC25A4, SLC25A5
Definition
(RefSeq) solute carrier family 25 member 4
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04217  Necroptosis
ocu04218  Cellular senescence
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100009414 (SLC25A4)
   04022 cGMP-PKG signaling pathway
    100009414 (SLC25A4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100009414 (SLC25A4)
   04218 Cellular senescence
    100009414 (SLC25A4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009414 (SLC25A4)
   05012 Parkinson disease
    100009414 (SLC25A4)
   05016 Huntington disease
    100009414 (SLC25A4)
   05017 Spinocerebellar ataxia
    100009414 (SLC25A4)
   05020 Prion disease
    100009414 (SLC25A4)
   05022 Pathways of neurodegeneration - multiple diseases
    100009414 (SLC25A4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009414 (SLC25A4)
   05164 Influenza A
    100009414 (SLC25A4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100009414 (SLC25A4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100009414 (SLC25A4)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100009414 (SLC25A4)
Transporters [BR:ocu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100009414 (SLC25A4)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 100009414
NCBI-ProteinID: NP_001076155
Ensembl: ENSOCUG00000002594
UniProt: O46373
LinkDB
Position
2
AA seq 298 aa
MSDQALSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGAAQREFSGLGNCLTKIFKSDGLRGLYQGFNVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt   +upstreamnt  +downstreamnt
atgagtgatcaggctttgagcttcctcaaggacttcctggcaggtggcgtcgccgctgcc
gtctccaagactgcggtcgcccccatcgagagggtcaaactgctgctgcaggtccagcat
gccagcaaacagatcagcgctgagaagcagtacaaagggatcattgattgtgtggtgagg
atccccaaggagcagggctttctctccttctggaggggtaacctggccaacgtgatccgg
tacttccccacccaagctctcaacttcgccttcaaggacaagtacaagcagatcttcttg
gggggcgtggatcggcataagcagttctggcgctacttcgctggtaacctggcctccggt
ggggcagctggggccacctccctctgctttgtctacccgctggactttgccaggaccagg
ttggctgccgacgtgggcaagggtgccgcccagcgtgagttcagtggtctgggcaactgt
ctcaccaagatcttcaagtctgatggcctgaggggtctctaccagggtttcaatgtctct
gtgcaaggcatcattatctacagagctgcctacttcggagtctatgatactgccaagggg
atgttgcctgaccccaagaacgtgcacattatcgtgagctggatgatcgcccagaccgtg
acggcagtggccgggctggtgtcctacccctttgacactgttcgtcgtaggatgatgatg
cagtctggccggaaaggggctgacattatgtacacggggacagttgactgctggaagaag
attgcaaaagatgaaggagccaaggctttcttcaaaggtgcctggtccaatgtgttgaga
ggcatgggtggcgcttttgtattggtgttgtatgatgagatcaaaaaatatgtctaa

KEGG   Oryctolagus cuniculus (rabbit): 100337764
Entry
100337764         CDS       T03373                                 

Gene name
SLC25A5
Definition
(RefSeq) solute carrier family 25 member 5
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04217  Necroptosis
ocu04218  Cellular senescence
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100337764 (SLC25A5)
   04022 cGMP-PKG signaling pathway
    100337764 (SLC25A5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100337764 (SLC25A5)
   04218 Cellular senescence
    100337764 (SLC25A5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100337764 (SLC25A5)
   05012 Parkinson disease
    100337764 (SLC25A5)
   05016 Huntington disease
    100337764 (SLC25A5)
   05017 Spinocerebellar ataxia
    100337764 (SLC25A5)
   05020 Prion disease
    100337764 (SLC25A5)
   05022 Pathways of neurodegeneration - multiple diseases
    100337764 (SLC25A5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100337764 (SLC25A5)
   05164 Influenza A
    100337764 (SLC25A5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100337764 (SLC25A5)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100337764 (SLC25A5)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100337764 (SLC25A5)
Transporters [BR:ocu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100337764 (SLC25A5)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 100337764
NCBI-ProteinID: XP_002720308
Ensembl: ENSOCUG00000013268
UniProt: G1T524
LinkDB
Position
X
AA seq 298 aa
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIRGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKFT
NT seq 897 nt   +upstreamnt  +downstreamnt
atgacagatgccgctgtgtccttcgccaaggactttctggcaggtggagtggctgcggcc
atctccaagaccgcggtagcgcccatcgagagggtcaagctgctgctgcaggtgcagcat
gccagcaagcaaatcactgccgataagcaatacaagggcattatagactgcgtggttcgt
atccccaaggagcagggagtcctgtccttctggcgtggtaacctggccaatgtcatcaga
tacttccccacccaggctctcaactttgccttcaaagataaatacaagcagatctttctg
ggtggcgtggacaagaggacccagttttggcgctactttgcaggaaatctggcatcaggt
ggtgctgctggagccacatccttgtgtttcgtgtaccctcttgattttgcccgtacccgt
ctagcagctgacgtgggcaaagctggagctgaaagggaattcagaggcctcggcgactgc
ctggttaagatctacaaatctgatgggattaggggcctgtaccaaggctttaatgtgtct
gtacagggcattatcatctaccgggctgcctacttcggtatctatgacaccgcaaaagga
atgcttccagatcccaagaacacacacatcttcatcagctggatgattgcgcagtctgtc
actgctgttgctgggttgacttcctatccatttgacactgttcgtcggcgcatgatgatg
cagtcggggcgtaaaggaactgatatcatgtacacaggcacacttgactgctggaggaag
attgctcgtgatgaaggaggcaaagcgtttttcaagggtgcatggtccaacgtcctcaga
ggcatgggtggtgcttttgtgcttgtcttgtatgatgaaatcaagaagttcacataa

KEGG   Oryctolagus cuniculus (rabbit): 100346477
Entry
100346477         CDS       T03373                                 

Gene name
SLC25A31
Definition
(RefSeq) solute carrier family 25 member 31
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04217  Necroptosis
ocu04218  Cellular senescence
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100346477 (SLC25A31)
   04022 cGMP-PKG signaling pathway
    100346477 (SLC25A31)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100346477 (SLC25A31)
   04218 Cellular senescence
    100346477 (SLC25A31)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100346477 (SLC25A31)
   05012 Parkinson disease
    100346477 (SLC25A31)
   05016 Huntington disease
    100346477 (SLC25A31)
   05017 Spinocerebellar ataxia
    100346477 (SLC25A31)
   05020 Prion disease
    100346477 (SLC25A31)
   05022 Pathways of neurodegeneration - multiple diseases
    100346477 (SLC25A31)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100346477 (SLC25A31)
   05164 Influenza A
    100346477 (SLC25A31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100346477 (SLC25A31)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100346477 (SLC25A31)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100346477 (SLC25A31)
Transporters [BR:ocu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100346477 (SLC25A31)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 100346477
NCBI-ProteinID: XP_002717308
Ensembl: ENSOCUG00000015617
LinkDB
Position
15
AA seq 322 aa
MQREPAKKKPEKKAEKRLFDAASFGRDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQ
ISPETRYKGMVDCLVRIPREQGFFSYWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVN
KEKQFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKI
AKSDGIVGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKETPFLISFFIAQVVTTCS
GILSYPFDTVRRRMMMQSGEAERQYKGTLDCFVKIYQHEGINAFFRGAFSNILRGTGGAL
VLVLYDKIKEFLKIDIGGGSSD
NT seq 969 nt   +upstreamnt  +downstreamnt
atgcagcgtgagcctgccaagaagaagccggagaagaaggctgagaagcggctgtttgac
gccgcatccttcggaagggacctgctggccggcggggtcgcggcggctgtgtccaagacg
gcagtggcgcccatcgagcgggtgaagctcctcctgcaggtgcaggcgtcgtccaagcag
atcagccccgagacgcgctacaagggcatggtggactgcctggtgcggattccccgcgag
cagggtttctttagttattggcgaggcaatttggcaaatgttatccggtactttccaaca
caagctctaaattttgcttttaaagacaaatacaaacaacttttcatgtctggagttaat
aaagaaaaacagttctggaggtggtttttggcaaacctggcttctggtggagctgccgga
gcaacatctttgtgtgtggtttatcctctagattttgcccgaactcggttaggtgttgac
attggaaaaggtcctgaagagcgacaattcaagggtctaggtgactgcattatgaaaata
gcaaaatcagatggcatagttggtttataccaagggtttggtgtttcagttcagggaatc
attgtgtaccgagcctcttactttggagcttatgacacagttaagggcttattaccaaaa
ccaaaagaaactccatttcttatctcctttttcattgctcaagttgtgactacatgctct
ggaatactctcttacccctttgatacagtgagaagacgcatgatgatgcagagtggtgaa
gctgaacggcagtataaaggaaccttagactgctttgtgaagatataccaacatgaggga
atcaatgcattttttcgtggtgccttctccaatatccttcgtggtacagggggtgctttg
gtgttggtgttatatgataaaattaaagaattccttaaaattgatattggaggtggttca
tcagattaa

KEGG   Oryctolagus cuniculus (rabbit): 100349768
Entry
100349768         CDS       T03373                                 

Definition
(RefSeq) ADP/ATP translocase 1
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04217  Necroptosis
ocu04218  Cellular senescence
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100349768
   04022 cGMP-PKG signaling pathway
    100349768
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100349768
   04218 Cellular senescence
    100349768
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100349768
   05012 Parkinson disease
    100349768
   05016 Huntington disease
    100349768
   05017 Spinocerebellar ataxia
    100349768
   05020 Prion disease
    100349768
   05022 Pathways of neurodegeneration - multiple diseases
    100349768
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100349768
   05164 Influenza A
    100349768
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100349768
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100349768
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100349768
Transporters [BR:ocu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100349768
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 100349768
NCBI-ProteinID: XP_002715967
Ensembl: ENSOCUG00000024057
UniProt: O46373
LinkDB
Position
13
AA seq 298 aa
MSDQALSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGAAQREFSGLGNCLTKIFKSDGLRGLYQGFNVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt   +upstreamnt  +downstreamnt
atgagtgatcaggctttgagcttcctcaaggacttcctggcaggtggcgtcgccgctgcc
gtctccaagactgcggtcgcccccatcgagagggtcaaactgctgctgcaggtccagcat
gccagcaaacagatcagcgctgagaagcagtacaaagggatcattgattgtgtggtgagg
atccccaaggagcagggctttctctccttctggaggggtaacctggccaacgtgatccgg
tacttccccacccaagctctcaacttcgccttcaaggacaagtacaagcagatcttcttg
gggggcgtggatcggcataagcagttctggcgctacttcgctggtaacctggcctccggt
ggggcagctggggccacctccctctgctttgtctacccgctggactttgccaggaccagg
ttggctgccgacgtgggcaagggtgccgcccagcgtgagttcagtggtctgggcaactgt
ctcaccaagatcttcaagtctgatggcctgaggggtctctaccagggtttcaatgtctct
gtgcaaggcatcattatctacagagctgcctacttcggagtctatgatactgccaagggg
atgttgcctgaccccaagaacgtgcacattatcgtgagctggatgatcgcccagactgtg
acggcagtggccgggctggtgtcctacccctttgacactgttcgtcgtaggatgatgatg
cagtctggccggaaaggggctgacattatgtacacggggacagttgactgctggaagaag
attgcaaaagatgaaggagccaaggctttcttcaaaggtgcctggtccaatgtgttgaga
ggcatgggtggcgcttttgtattggtgttgtatgatgagatcaaaaaatatgtctaa

KEGG   Oryctolagus cuniculus (rabbit): 100356326
Entry
100356326         CDS       T03373                                 

Definition
(RefSeq) ADP/ATP translocase 2
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04217  Necroptosis
ocu04218  Cellular senescence
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100356326
   04022 cGMP-PKG signaling pathway
    100356326
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100356326
   04218 Cellular senescence
    100356326
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100356326
   05012 Parkinson disease
    100356326
   05016 Huntington disease
    100356326
   05017 Spinocerebellar ataxia
    100356326
   05020 Prion disease
    100356326
   05022 Pathways of neurodegeneration - multiple diseases
    100356326
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100356326
   05164 Influenza A
    100356326
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100356326
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100356326
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100356326
Transporters [BR:ocu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100356326
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 100356326
NCBI-ProteinID: XP_002720265
UniProt: G1T524
LinkDB
Position
X
AA seq 298 aa
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIRGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKFT
NT seq 897 nt   +upstreamnt  +downstreamnt
atgacagatgccgctgtgtccttcgccaaggactttctggcaggtggagtggctgcggcc
atctccaagaccgcggtagcgcccatcgagagggtcaagctgctgctgcaggtgcagcat
gccagcaagcaaatcactgccgataagcaatacaagggcattatagactgcgtggttcgt
atccccaaggagcagggagtcctgtccttctggcgtggtaacctggccaatgtcatcaga
tacttccccacccaggctctcaactttgccttcaaagataaatacaagcagatctttctg
ggtggcgtggacaagaggacccagttttggcgctactttgcaggaaatctggcatcaggt
ggtgctgctggagccacatccttgtgttttgtgtaccctcttgattttgcccgtacccgt
ctagcagctgacgtgggcaaagctggagctgaaagggaattcagaggcctcggcgactgc
ctggttaagatctacaaatctgatgggattaggggcctgtaccaaggctttaatgtgtct
gtacagggcattatcatctaccgggctgcctacttcggtatctatgacaccgcaaaagga
atgcttccagatcccaagaacacgcacatcttcatcagctggatgatcgcgcagtctgtc
actgctgttgctgggttgacttcctatccatttgacactgttcgtcggcgcatgatgatg
cagtccgggcgtaaaggaactgatatcatgtacacaggcacacttgactgctggaggaag
attgctcgtgatgaaggaggcaaagcgtttttcaagggtgcatggtctaacgtcctcaga
ggcatgggtggtgcttttgtgcttgtcttgtatgatgaaatcaagaagttcacataa

DBGET integrated database retrieval system