KEGG   Oryctolagus cuniculus (rabbit): 100009482
Entry
100009482         CDS       T03373                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04915  Estrogen signaling pathway
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05223  Non-small cell lung cancer
ocu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009482 (TGFA)
   04012 ErbB signaling pathway
    100009482 (TGFA)
   04014 Ras signaling pathway
    100009482 (TGFA)
   04151 PI3K-Akt signaling pathway
    100009482 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100009482 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009482 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100009482 (TGFA)
   05212 Pancreatic cancer
    100009482 (TGFA)
   05225 Hepatocellular carcinoma
    100009482 (TGFA)
   05214 Glioma
    100009482 (TGFA)
   05211 Renal cell carcinoma
    100009482 (TGFA)
   05215 Prostate cancer
    100009482 (TGFA)
   05223 Non-small cell lung cancer
    100009482 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100009482 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 100009482
NCBI-ProteinID: XP_008252499
Ensembl: ENSOCUG00000029636
LinkDB
Position
2
AA seq 159 aa
MVTSAGQLALFALGILLAVCQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALVCRHEKPSALLKGRSACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcacctcggctggacagctcgccctgttcgcgctcggcatcctgctggctgtgtgc
caagccctggagaacagcacgtcgcccctcagtgacccgcctgtggccgcagcagtggtg
tcccattttaacgactgcccagactcccacactcagttctgcttccatggaacctgcagg
tttttggtgcaggaggacaagccagcatgtgtctgccactctggctacgtcggggcccgc
tgtgagcacgcggacctcctggccgtggtggccgccagccagaagaagcaggccatcact
gccttggtggtggtctccattgtggccctggctgtcctcatcatcacgtgtgtgctgata
cactgctgccaggtccggaaacactgtgagtggtgccgggccctcgtgtgccggcatgag
aagcccagtgccctcctgaagggaaggagcgcctgctgccactcggagacagtggtctga

DBGET integrated database retrieval system