KEGG   Oryctolagus cuniculus (rabbit): 100009497
Entry
100009497         CDS       T03373                                 

Gene name
TLR4
Definition
(RefSeq) toll like receptor 4
  KO
K10160  toll-like receptor 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04145  Phagosome
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05170  Human immunodeficiency virus 1 infection
ocu05205  Proteoglycans in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100009497 (TLR4)
   04066 HIF-1 signaling pathway
    100009497 (TLR4)
   04151 PI3K-Akt signaling pathway
    100009497 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100009497 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    100009497 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100009497 (TLR4)
   04621 NOD-like receptor signaling pathway
    100009497 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100009497 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100009497 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009497 (TLR4)
   05321 Inflammatory bowel disease
    100009497 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100009497 (TLR4)
   05135 Yersinia infection
    100009497 (TLR4)
   05133 Pertussis
    100009497 (TLR4)
   05134 Legionellosis
    100009497 (TLR4)
   05152 Tuberculosis
    100009497 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100009497 (TLR4)
   05162 Measles
    100009497 (TLR4)
   05164 Influenza A
    100009497 (TLR4)
   05161 Hepatitis B
    100009497 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100009497 (TLR4)
   05144 Malaria
    100009497 (TLR4)
   05145 Toxoplasmosis
    100009497 (TLR4)
   05140 Leishmaniasis
    100009497 (TLR4)
   05142 Chagas disease
    100009497 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100009497 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ocu04054]
    100009497 (TLR4)
   04090 CD molecules [BR:ocu04090]
    100009497 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009497 (TLR4)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    100009497 (TLR4)
Pattern recognition receptors [BR:ocu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100009497 (TLR4)
CD molecules [BR:ocu04090]
 Proteins
  100009497 (TLR4)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Hyaluronan
  Cell surface receptors
   100009497 (TLR4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_6 LRR_9 DUF1863 Curto_V2
Other DBs
NCBI-GeneID: 100009497
NCBI-ProteinID: NP_001076201
Ensembl: ENSOCUG00000002216
UniProt: Q8MIQ2
LinkDB
Position
Un
AA seq 839 aa
MMPRLRLAGTLVPAMAFLSYLRPEIWEPCVEVVPNITYQCMEKNLYKIPDNIPFSTKNLD
LSFNLLEHLGSHSFLHVSELHFLDLSRCKIHTIEDDAYQGLKNLSTLILTGNPIQSLSPQ
AFSGLSNLQKLVAVETHLTSLGDFPIGHLKTLKELNVAHNLIHSFSIPDYFSNLSSLEHL
DLSNNKIQSIYHKDLRVLHQMPLGTLSLDLALNPIDFIPPGAFEAIRLHELILKSNFKST
NIMKICIQGLSGLEVHRLVLGEFKNERNMKNFDKSALEGLCNLAIEEFRLAYIDDLEGNI
TDLFDCLENVSVMALVHMYIDNQEIFPKDFSWKSLEFINCEFSENIFFLKLSSLRRLIFT
ANKGVRTFPELNTPSLEFLDISNNGLSLQSCCSVNSLRLTQLKHLNLSFNGVITMTSNFV
GLEQLEHLYFQHSNLRNINEFSIFLSLNNLLYLDISYTHIRVAFRGIFDGLYSLRVLKMA
GNAFQDNRLLNIFTEMTSLTTLDLSSCQLEQVYQGAFESLPRLESLNMSHNNLLVLDTLT
YKCLYSLQVLDLSFNHIGNITEPGQQHFPSNLTLLHLTKNAFVCDCEHQIFMQWIKDQRR
LLVEVEQMVCITPPNMPVLSFTNATCQISKTIISVSVFSVLVVSFAVVLVYKFYFPLMLL
VGRRKYGRGESVYDAFVIYSSQDEDWVRNELVKNLEEGVPPFRLCLHYRDFIPGVAIAAN
IIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSHAGIIFIVLQKVEKSLLRQ
RVELYRLLSRNTYLEWEDTVLGRHIFWRRLRKALLDGKTLSPEGMARAENNQQEAMTLI
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgatgcctcgcctgcgcctggctgggactctggtcccagccatggccttcctttcctac
ttgagaccagaaatctgggagccctgtgtggaggtcgttcccaatattacttaccagtgc
atggagaagaatctctacaaaatccctgacaacattcccttctcaaccaagaacctggat
ctgagttttaacctcctggagcatttaggcagccatagcttcttgcatgtctcagaactg
cactttctggatttatccaggtgtaaaattcatacaattgaagatgatgcataccaaggc
ctaaagaatctctctaccttgatattgacaggaaaccctatccaaagcttatccccacaa
gctttttctggactatcaaatttgcagaaactagtggctgtggagacacacctgacctct
ctaggggacttccctattggacatctcaaaaccttgaaggagcttaatgtggcccataat
cttatccattccttcagtattcctgactatttttctaacctgtctagccttgagcacctg
gacctttcaaataacaagattcaaagtatttatcataaagacttgcgtgttctacatcaa
atgcccctaggcacactctctttagacctggctttgaaccctatagattttatccccccc
ggtgcctttgaagcaattagactccacgaactgattttgaaaagtaattttaaaagtaca
aatataatgaagatctgtattcaagggctgagtggtttagaagttcaccggttggttttg
ggagaatttaaaaatgaaagaaacatgaaaaattttgataaatctgccctggagggactt
tgcaatttggctattgaagaattccgattagcatacatagatgacctcgaaggcaatatt
actgacttatttgattgtttggaaaatgtttctgtaatggctctggtgcatatgtatata
gacaaccaagaaatttttcctaaagatttcagctggaaatcattagaatttattaactgt
gaatttagtgaaaatattttcttcttgaagctctcatctctcagaagacttattttcact
gccaacaaaggtgtgaggacttttccagaacttaacacaccaagccttgagtttctagat
atcagcaataatggtttgagtctccaaagctgctgttctgtgaatagtttgagactgacc
caactcaagcatttaaatctgagcttcaatggtgttattaccatgacatcaaactttgtg
ggcttagaacaactggaacatctgtatttccaacattccaatttgagaaacatcaatgaa
ttttcaatattcttatcactcaacaacctcctttaccttgacatttcctatactcacatc
cgagttgccttccgtggcatctttgatggtttatacagtctccgagtcttaaaaatggct
ggaaatgctttccaggacaacaggcttctgaatatcttcacagagatgactagcttgacc
accctggacctttcttcatgtcaactagaacaggtgtaccagggagcatttgagtcactc
cccagactggagtcactaaatatgagtcacaacaacctgttggtattggatacactcact
tataaatgtctctactccctccaggttctggatttaagtttcaatcacataggaaatatt
acagagccagggcagcagcattttccaagtaatctaactttattacatcttactaagaat
gcctttgtttgtgattgtgaacatcagattttcatgcagtggatcaaagaccagaggagg
ctgttggtggaagttgaacaaatggtgtgcatcacacctccaaatatgcctgtgctgagt
tttacaaatgccacctgtcagataagcaagaccatcattagcgtgtcagtattcagtgtg
cttgtggtatcttttgctgtagttctggtttataagttctattttcctttgatgcttcta
gttggccgaagaaagtatggtaggggtgaaagcgtctatgatgcctttgttatctactca
agccaggatgaggactgggtgagaaatgagttagtaaagaacttagaagaaggagtgcct
ccctttcggctctgccttcactatagagactttattcctggtgtggccatcgctgccaac
atcatccaggaaggtttccacaagagccggaaggttattgttgtagtgtcccagcacttc
atccagagccgctggtgtatctttgaatatgagattgctcagacctggcagtttttgagc
agccatgcgggtatcattttcattgtcctgcaaaaggtggagaagtccctactccggcag
cgggtggagctgtatcgccttctcagcaggaacacttacttggagtgggaagatactgtc
ctggggcggcatatcttctggagacggctcagaaaagccctactggatggaaaaacactg
agtccagagggaatggcaagggcagaaaacaaccaacaagaagcaatgactttgatctga

DBGET integrated database retrieval system