KEGG   Oryctolagus cuniculus (rabbit): 100009526Help
Entry
100009526         CDS       T03373                                 

Gene name
PFKP, ATP-PFK, PFK-P, PFKM
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00010  Glycolysis / Gluconeogenesis
ocu00030  Pentose phosphate pathway
ocu00051  Fructose and mannose metabolism
ocu00052  Galactose metabolism
ocu01100  Metabolic pathways
ocu01200  Carbon metabolism
ocu01230  Biosynthesis of amino acids
ocu03018  RNA degradation
ocu04152  AMPK signaling pathway
ocu05230  Central carbon metabolism in cancer
Module
ocu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100009526 (PFKP)
   00030 Pentose phosphate pathway
    100009526 (PFKP)
   00051 Fructose and mannose metabolism
    100009526 (PFKP)
   00052 Galactose metabolism
    100009526 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100009526 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100009526 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100009526 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100009526 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100009526 (PFKP)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100009526 (PFKP)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100009526 (PFKP)
Messenger RNA biogenesis [BR:ocu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100009526 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100009526
NCBI-ProteinID: NP_001076217
Ensembl: ENSOCUG00000011039
UniProt: P47859
LinkDB All DBs
Position
Un
AA seq 791 aa AA seqDB search
MDNKVSASPRGSYRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIVEANWESVSSILQVGGTIIGSARSKAFRTREGRLKAACNLIHRGIT
NLCVIGGSGSLTGANIFRMEWSGLLEELAQDGKIDNEAVQKYAYLNVVGMVGSIDNDFCG
TDMTIGTDSACHRIIEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRAQKKRLNIIIVAEGAIDTLNRPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATPETPACVVSLSGNHAVRLPLVEC
VQMTQEVQKAMDERRFKDAVQLRGRSFENNLNTYKRLAIKLPDDKIQKSNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHKMFAVYDGFDGFAKGQIKEIRWGDVGGWTGQGGSILGTK
RILPGKYLEEIATQIRTHNINAILIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGRG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWITTKLKESPGKGKRFVSDDSICVL
GISKRNVLFQPVAELKNETDFEHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLVPVR
HRGGPEEPAAI
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggacaacaaagtctctgcgagccccaggggctcctaccggaagttcctggagcacctc
tccggggccggcaaagccatcggcgtgctgaccagtggtggggatgcccaaggaatgaac
gctgctgtccgtgcggtggtgcgcatgggaatctacgtgggggccaaggtgtactttatt
tatgagggttaccaaggcatggtggatggaggttctaatattgtagaagccaactgggag
agtgtctcaagcattctacaagtgggtgggacgatcatcggcagcgcgcgctcgaaagcc
tttcggactcgcgagggccgcctcaaagctgcctgtaacttgatccaccggggcatcacg
aacctgtgtgtcattggtggcagtgggagtctcacaggggccaacatcttccggatggaa
tggagtggcttattggaggagctggcccaggatggcaagattgataacgaggctgtgcag
aagtatgcttacctcaacgtcgtgggcatggtgggctccatcgacaatgacttctgcggc
acggacatgaccattggcacggactcagcgtgccacagaatcatcgaagtcatcgatgcc
atcatgaccacggcccagagccaccagaggaccttcgttctggaggtgatgggaaggcac
tgtgggtacttggccctggtgagtgccttggcctgtggtgcagactgggtgttccttccg
gagtccccgccagaagaaggttgggaggaacagatgtgcgtcaagctctcggagaaccgg
gcccagaaaaaaaggctgaatattatcattgtggctgaaggagcaattgacaccctaaac
aggcccatcacctctgagaaaatcaaggagcttgtcgtgacacagctggggtacgacacc
cgagtgaccattctcggacacgtgcaaagaggagggaccccttcggcgtttgacaggatt
ctggccagtcgcatgggcgtggaggcggtcctcgccttgctggaggccacccctgagacc
ccggcctgtgtcgtgtcgctgagtgggaaccacgccgtgcgtctgcccctggtggagtgt
gtgcagatgactcaggaggtacaaaaggcaatggatgagagaagatttaaagacgctgtt
caactcagaggcaggagctttgagaacaacctgaacacttataagcgacttgccatcaag
cttccagatgataagatccaaaagagtaattgcaacgtggctgtcatcaatgtaggggcg
cccgccgctgggatgaacgcagctgtgcgctcggctgtgcgagtggggatcgctgatggt
cacaagatgtttgcagtctacgatggctttgacggctttgccaaaggccagatcaaagaa
attcgctggggagacgttggcggttggaccggccagggaggatccattctcgggacaaaa
cgtattctgcctggaaagtacttagaggagatcgccacccagatacgtacccataatatc
aacgccatattgattattggtggatttgaggcctacctgggactcctagagctgtctgct
gcccgggagaagcacgaggagttctgtgtcccaatggttatggttcctgctactgtctcc
aacaatgtcccaggttctgatttcagcattggggcagacacagctctgaacacgatcacc
gacacgtgtgaccgcatcaagcagtcagccagcgggaccaagcgacgcgtgtttatcatc
gagaccatgggcggctactgcggctacctggccaacatgggggggctcgcggccggagca
gacgccgcctacatctttgaagagccctttgacatcagagatttacagtccaacgtggag
cacctgacagagaaaatgaagaccactattcagaggggtcttgtgctcaggaacgagagc
tgcagtgaaaactacaccaccgacttcatctaccagctctactcggaagagggcagagga
gtgtttgactgcaggaagaatgtgctgggccacatgcagcagggtggagcaccttctccc
tttgataggaactttggaaccaaaatttcagccagagccatgcagtggattaccacgaaa
ctaaaggagtctcccggcaaaggaaaaagatttgtttcggatgattccatttgtgtgctg
ggaataagcaaaagaaatgttctttttcaacctgtggcagagctgaagaatgaaacagat
tttgagcacagaattcccaaagaacagtggtggctaaaactgcggcctctcatgaaaatc
ttggccaagtacaagacaagctatgacgtttccgactctggccaactcgtgcctgtccgc
catcgtggtggtcccgaggagcctgcagccatttga

DBGET integrated database retrieval system