KEGG   Oryctolagus cuniculus (rabbit): 100009554
Entry
100009554         CDS       T03373                                 

Gene name
ERBB2
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04020  Calcium signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04530  Tight junction
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05215  Prostate cancer
ocu05219  Bladder cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009554 (ERBB2)
   04012 ErbB signaling pathway
    100009554 (ERBB2)
   04066 HIF-1 signaling pathway
    100009554 (ERBB2)
   04020 Calcium signaling pathway
    100009554 (ERBB2)
   04151 PI3K-Akt signaling pathway
    100009554 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100009554 (ERBB2)
   04520 Adherens junction
    100009554 (ERBB2)
   04530 Tight junction
    100009554 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009554 (ERBB2)
   05206 MicroRNAs in cancer
    100009554 (ERBB2)
   05205 Proteoglycans in cancer
    100009554 (ERBB2)
   05230 Central carbon metabolism in cancer
    100009554 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100009554 (ERBB2)
   05226 Gastric cancer
    100009554 (ERBB2)
   05219 Bladder cancer
    100009554 (ERBB2)
   05215 Prostate cancer
    100009554 (ERBB2)
   05213 Endometrial cancer
    100009554 (ERBB2)
   05224 Breast cancer
    100009554 (ERBB2)
   05223 Non-small cell lung cancer
    100009554 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100009554 (ERBB2)
   01524 Platinum drug resistance
    100009554 (ERBB2)
   01522 Endocrine resistance
    100009554 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009554 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009554 (ERBB2)
   04090 CD molecules [BR:ocu04090]
    100009554 (ERBB2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100009554 (ERBB2)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100009554 (ERBB2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100009554 (ERBB2)
CD molecules [BR:ocu04090]
 Proteins
  100009554 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 100009554
NCBI-ProteinID: XP_002719389
Ensembl: ENSOCUG00000010569
UniProt: G1SZL0
LinkDB
Position
19
AA seq 1255 aa
MELAAWYRWGLLLALLPPGTAGTQVCTGTDMKLRFPASPETHLDMLRYLYQGCQVVQGNL
ELTYLPANASLSFLQDIQEVQGYVLIAHNQVRHIPLQRLRIVRGTQLFEDNFALAVLDNG
DPRDNATPAAGAPPGGLRELRLRSLTEILKGGVLIQRNPQLCYQDTILWQDIFHKNNQLA
LTRINASRARTCPPCSPACQASGCWGESPEDCQSLTRTICAGGCARCKGQLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTTCP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFEGDPASATAPLLPEQLRVFGTLEEITGYLYIAAWPDSLP
DLSVFQNLQVIRGRVLHDGAYSLTLQGLGIRWLGLRSLRELGSGLALIHRNPHLCFVHTV
PWEQLFRNPHQALLHSGNQPEDECAGKGQACYPLCAHGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVSDRHCLPCHPECQPQNGSVTCFGSEADQCVACAHYKDPPSCVARC
PSGVKPDLSYMPVWKFPDEEGTCQPCPINCTHACVDLDDKGCPAEQRASPVTSIIAAVVG
ILLVVVMGSVLGIFIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGAGGTAHRRHRSSSTRSGGGELPLGLEPTEEEPPRSPLAPSEG
AGSDVFDGDLGMGAAKGLQSLPPHDPNPLQRYSEDPTGPLPPDTDGYVAPLTCSPQPEYV
NQPEVRPQPPSPLEGPAPPARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAPR
GGAAPQPHSPPAFSPAFDNLYYWDQDPAERGSPPSTFEGTPTAENPEYLGLDVPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtaccgctgggggctcctcctcgcccttttgccccccggaacc
gcgggcacccaagtgtgcaccggcacagacatgaagctgcggttcccggccagtcccgag
acccacctggacatgcttcgctacctctaccagggctgtcaggtggtgcaggggaacctg
gaactcacctacctgcccgccaatgccagtctctccttcctgcaggacatccaggaggta
cagggctacgtgctcatcgcccacaaccaggtgcggcacatcccgctgcagaggctgcgc
atcgtgcgaggcacccagctcttcgaggacaacttcgccctggccgtgctggacaatgga
gacccgcgggacaacgccacgccagccgcgggggcccccccgggagggctgcgggagctg
cggcttcggagcctcacagagatcctgaagggaggggtcttgatccagcggaacccccag
ctctgctaccaggacacgattctgtggcaggacatcttccacaagaacaaccagctggcc
ctcacgcggataaatgccagccgtgcccggacctgcccaccctgttctccagcttgtcaa
gcctccggctgctggggagaaagtcccgaggactgtcagagcctgacacgcaccatttgt
gccggaggctgtgcccgctgcaagggccagctgcccacggactgttgccatgagcagtgc
gccgccggctgcacgggccccaagcactccgactgcctggcctgcctgcacttcaaccac
agtggcatctgcgagctgcactgcccggccctggtcacctacaacacggacacctttgag
tccatgcccaaccccgagggccgttacaccttcggcgccagctgtgtgaccacctgtccc
tacaactacctgtctacggacgtgggctcctgcaccttggtctgtcccctgcacaaccaa
gaggtgacggctgaggacgggacacagcggtgtgagaaatgcagcaagccctgtgcacga
gtgtgctacggcctgggcatggagcacctgcgggaggtgcgggcggtcacgagtgccaac
atccaggagttcgccggctgcaagaagatctttgggagcctggcatttctgccagagagc
tttgaaggggacccagcctctgccaccgcccccctcctgcctgagcagctcagagtgttt
gggaccctggaggagataacaggttacctgtacattgcggcctggccagacagcctgccg
gatctcagcgtcttccagaaccttcaagtcatccggggacgagttctgcatgacggcgcc
tactcgctgaccctgcaaggcctgggcatccgctggctggggctgcgctcgctgcgggag
ctgggcagtggcctggccctcatccaccgcaacccccacctctgcttcgtgcacacggtg
ccctgggagcagctcttccggaacccgcaccaggcgctgctgcacagcggcaatcagcca
gaggacgagtgtgcgggcaagggccaggcctgctacccgctgtgcgcccatgggcactgc
tgggggccggggcccacccagtgcgtcaactgcagccagttccttcggggccaggagtgc
gtggaggaatgccgagtgctacaggggctccccagggagtatgtcagtgacaggcactgt
ctgccgtgtcaccccgagtgtcagccccagaatggctcggtcacctgctttggatcggag
gccgaccagtgtgtggcctgtgcccactacaaggaccctccctcctgcgtggctcgctgc
cccagcggggtgaaacccgacctgtcctacatgcccgtctggaagttcccggatgaggaa
ggcacatgccagccgtgccccatcaactgcacccatgcctgcgtggacctggatgacaaa
ggctgccccgcggagcagagagccagccctgtcacgtccatcatcgctgctgtggtgggc
attctgctggtcgtggtcatggggtcagtcctcgggatcttcatcaagcgaaggcggcag
aagatccggaagtacaccatgcggaggctgctgcaggaaacggagctggtggagccacta
acacccagcggagcgatgcccaaccaggctcagatgcggatcctgaaggagacggagctg
aggaaggtgaaggtgcttggatcaggagctttcggcacagtgtacaagggcatctggatc
cccgatggggagaatgtgaaaatcccggtggccatcaaagtgttgcgggaaaacacatcc
cctaaagccaacaaagagatcctggacgaagcatacgtgatggcaggggtgggctccccc
tatgtgtcccgcctcctgggcatctgcttgacgtccacggtgcagctggtgacacagctg
atgccctacggctgcctcctggaccatgtccgtgaacaccgcgggcgcctgggctcacag
gacttactgaactggtgtgtgcaaattgccaaggggatgagctacttggaagacgtgcgg
ctcgtgcacagggacctggctgcacggaacgtgctggtcaagagccccaaccacgtcaag
atcacagacttcgggctggctcggctgctggacattgacgagacagagtaccacgcggac
gggggcaaggtgcccatcaagtggatggcgttggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagctacggggtgactgtctgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcccgggaaatccctgacctgctggagaagggggagcgg
ctgccccagccccccatctgcaccatcgatgtctacatgatcatggtcaaatgttggatg
attgactcggaatgccggcccagattccgggagttggtggctgaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaggacctgggccccgccagcccgttg
gacagcaccttctaccgctcgttgctggaggatgatgacatgggggacctggtggacgct
gaggagtacctggtgccccagcagggcttcttctgcccagaccctgctccgggcgctggg
ggtacagcccaccgcaggcaccgcagctcgtccacccggagtggtggcggtgagctgccg
ttggggctggagcccaccgaagaggagccccccaggtctccactggccccctcagaaggg
gctggctccgacgtattcgatggcgacctggggatgggggcagccaaggggctgcagagc
ctcccgccacacgaccccaaccctctgcaacggtacagtgaggaccccacaggacccctg
cccccggacactgacggctacgttgcccccctgacctgcagcccccagcccgagtatgtg
aaccagccagaggtccggccgcagcccccctcgcccctggagggccctgcaccgcctgcc
cggccagccggggccaccctggaaaggcccaagactctctcccccgggaagaatggggtt
gtcaaagacgtttttgcctttgggggtgccgtggagaaccccgagtacttggcaccccgg
ggaggggctgcccctcagccccactctcctcctgccttcagcccagcctttgacaacctc
tattattgggaccaggacccagcagagcgggggtccccacccagcacctttgaagggacc
cctacggcagagaaccccgagtacctgggcctggacgtgccggtgtga

DBGET integrated database retrieval system