KEGG   Oryctolagus cuniculus (rabbit): 100037720
Entry
100037720         CDS       T03373                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04510  Focal adhesion
ocu04540  Gap junction
ocu04650  Natural killer cell mediated cytotoxicity
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04670  Leukocyte transendothelial migration
ocu04713  Circadian entrainment
ocu04720  Long-term potentiation
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04727  GABAergic synapse
ocu04728  Dopaminergic synapse
ocu04730  Long-term depression
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04919  Thyroid hormone signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04929  GnRH secretion
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu04960  Aldosterone-regulated sodium reabsorption
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu05017  Spinocerebellar ataxia
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05031  Amphetamine addiction
ocu05032  Morphine addiction
ocu05143  African trypanosomiasis
ocu05146  Amoebiasis
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05214  Glioma
ocu05223  Non-small cell lung cancer
ocu05225  Hepatocellular carcinoma
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100037720 (PRKCA)
   04012 ErbB signaling pathway
    100037720 (PRKCA)
   04014 Ras signaling pathway
    100037720 (PRKCA)
   04015 Rap1 signaling pathway
    100037720 (PRKCA)
   04310 Wnt signaling pathway
    100037720 (PRKCA)
   04370 VEGF signaling pathway
    100037720 (PRKCA)
   04066 HIF-1 signaling pathway
    100037720 (PRKCA)
   04020 Calcium signaling pathway
    100037720 (PRKCA)
   04070 Phosphatidylinositol signaling system
    100037720 (PRKCA)
   04072 Phospholipase D signaling pathway
    100037720 (PRKCA)
   04071 Sphingolipid signaling pathway
    100037720 (PRKCA)
   04151 PI3K-Akt signaling pathway
    100037720 (PRKCA)
   04150 mTOR signaling pathway
    100037720 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100037720 (PRKCA)
   04540 Gap junction
    100037720 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100037720 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    100037720 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    100037720 (PRKCA)
   04670 Leukocyte transendothelial migration
    100037720 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    100037720 (PRKCA)
   04929 GnRH secretion
    100037720 (PRKCA)
   04912 GnRH signaling pathway
    100037720 (PRKCA)
   04921 Oxytocin signaling pathway
    100037720 (PRKCA)
   04926 Relaxin signaling pathway
    100037720 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    100037720 (PRKCA)
   04918 Thyroid hormone synthesis
    100037720 (PRKCA)
   04919 Thyroid hormone signaling pathway
    100037720 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    100037720 (PRKCA)
   04916 Melanogenesis
    100037720 (PRKCA)
   04925 Aldosterone synthesis and secretion
    100037720 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100037720 (PRKCA)
   04270 Vascular smooth muscle contraction
    100037720 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    100037720 (PRKCA)
   04971 Gastric acid secretion
    100037720 (PRKCA)
   04972 Pancreatic secretion
    100037720 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100037720 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100037720 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100037720 (PRKCA)
   04727 GABAergic synapse
    100037720 (PRKCA)
   04725 Cholinergic synapse
    100037720 (PRKCA)
   04728 Dopaminergic synapse
    100037720 (PRKCA)
   04726 Serotonergic synapse
    100037720 (PRKCA)
   04720 Long-term potentiation
    100037720 (PRKCA)
   04730 Long-term depression
    100037720 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    100037720 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100037720 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    100037720 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100037720 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100037720 (PRKCA)
   05206 MicroRNAs in cancer
    100037720 (PRKCA)
   05205 Proteoglycans in cancer
    100037720 (PRKCA)
   05231 Choline metabolism in cancer
    100037720 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100037720 (PRKCA)
   05214 Glioma
    100037720 (PRKCA)
   05223 Non-small cell lung cancer
    100037720 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100037720 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    100037720 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100037720 (PRKCA)
   05032 Morphine addiction
    100037720 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100037720 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100037720 (PRKCA)
   05164 Influenza A
    100037720 (PRKCA)
   05161 Hepatitis B
    100037720 (PRKCA)
   05163 Human cytomegalovirus infection
    100037720 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100037720 (PRKCA)
   05143 African trypanosomiasis
    100037720 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100037720 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100037720 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100037720 (PRKCA)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100037720 (PRKCA)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100037720 (PRKCA)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100037720 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 100037720
NCBI-ProteinID: NP_001095194
Ensembl: ENSOCUG00000007362
UniProt: P10102
LinkDB
Position
19
AA seq 672 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEDGNVE
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALMDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVVTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSSV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaagaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaagcaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgttaccttttcttgtccgggtgcggataagggacctgacactgatgaccccaggagc
aagcacaagtttaaaatccacacctacgggagccccaccttctgcgatcactgtgggtca
ctgctgtacggactcatccaccaggggatgaaatgtgacacctgcgacatgaacgttcac
aagcagtgtgtgatcaatgtccccagcctgtgtgggatggaccatacggagaagagggga
cggatctacctgaaggccgaggtcaccgatgaaaagctccacgtcacggtacgagatgca
aaaaacctgatccccatggatcccaacgggctttcagatccctacgtgaagctgaaactc
attcctgatcccaagaatgaaagcaaacaaaaaaccaaaaccatccgctccacgctgaac
ccgcagtggaacgaatcctttaccttcaaattaaaaccctccgacaaagaccgacgactg
tctgtagaaatctgggactgggaccgaacaacaaggaatgacttcatggggtcgctctcc
tttggcgtctcggagctcatgaagatgccagccagtggatggtacaagttgctgaaccaa
gaagaaggtgaatactacaatgtgcccattccggaaggggacgaagatgggaacgtggag
ctcaggcagaaattcgagaaagccaagctggggcccgctggcaacaaggtgatcagtccc
tcggaagacaggaagcagccgtccaacaacctggaccgagtgaagctcaccgacttcaac
ttcctcatggtcctgggaaaaggcagttttgggaaggtgatgctggcggacaggaagggc
acggaagagctgtacgccatcaagatcctgaagaaggacgtggtgattcaggatgacgac
gtggagtgcaccatggtggagaagcgggttctggccctgatggacaagccgcccttcctg
acacagctgcactcctgcttccagaccgtggaccggctgtactttgtcatggaatacgtc
aacggcggagacctcatgtaccacatccagcaagtgggaaagttcaaggagccacaagca
gtattctatgcagcagagatttccattgggctgttcttccttcacaaaagagggatcatc
tatagggacctgaagctagataacgtcatgctggactcggaaggacacatcaaaatcgct
gactttgggatgtgcaaggaacacatgatggacggggtcaccaccaggaccttctgtggg
actccagattacatcgccccggagatcatcgcttatcagccgtacggcaaatccgtggac
tggtgggcctacggcgtcctgctgtatgagatgctggctgggcagcctccatttgatggc
gaggacgaagacgagctgtttcagtccatcatggagcacaacgtttcctaccccaaatcc
ttgtccaaggaggccgtctccatctgcaaggggctgatgaccaaacacccggccaagcgg
ctgggctgcgggcccgagggagagcgggacgtgagggaacacgccttcttccggaggatc
gactgggagaaactggagaacagggagatccagccgccgttcaagcccaaagtgtgtggc
aaaggagcagaaaacttcgacaagttcttcacgcgagggcagcccgtcgtcacgccgccg
gatcaactggtcatcgctaacatagaccagtctgatttcgaagggttctcgtatgtcaac
ccccagttcgtgcacccgatcctacagagctcagtatga

DBGET integrated database retrieval system