KEGG   Oryctolagus cuniculus (rabbit): 100101588
Entry
100101588         CDS       T03373                                 

Gene name
CASP1
Definition
(RefSeq) caspase 1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04217  Necroptosis
ocu04621  NOD-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100101588 (CASP1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100101588 (CASP1)
   04623 Cytosolic DNA-sensing pathway
    100101588 (CASP1)
   04625 C-type lectin receptor signaling pathway
    100101588 (CASP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100101588 (CASP1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100101588 (CASP1)
   05135 Yersinia infection
    100101588 (CASP1)
   05133 Pertussis
    100101588 (CASP1)
   05134 Legionellosis
    100101588 (CASP1)
  09172 Infectious disease: viral
   05164 Influenza A
    100101588 (CASP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100101588 (CASP1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100101588 (CASP1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     100101588 (CASP1)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C14: caspase family
   100101588 (CASP1)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100101588 (CASP1)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 100101588
NCBI-ProteinID: XP_008260265
Ensembl: ENSOCUG00000001103
UniProt: A0A5F9DPF5
LinkDB
Position
1
AA seq 403 aa
MADRILKDRRKRFINSVGTGTINGLLDELLEKRVLNQEEMEKVRVENATVMDKARALLDC
VIRKGPQACQICINHICEDDCHLAGLLGLSSGPQSENHFNAQDSLEAFSSFSAPQTTQDN
QVVFTFSGPSLKLCPLETAQRIWKEKSEEIYPIKMQSSGRTRLALIICNTEFDSLPRRTG
ADVDIRDMKMLLIGLGYSVDVKENLNALDMATELKAFADRPEHWTSDSTFLVFMSHGTRD
GICGKNYSEQYSDILNVNTIFEMLNTKNCQSLKDKPKVIIIQACRGENQGIVWLKDSIGD
SGNTSLLNPDDFEYDASRIAHIEKDFIAFCSSTPDNVSWRHPKQGSLFIMRLIKTMQEYA
WSCDVEEIFRKVRFSFELPEGRTQMPTTERVTLTRRFYLFPGH
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggctgacaggattctaaaggacaggaggaagcggtttatcaactcggtgggcacaggt
acaataaatggcttactggatgaattgttggagaaaagagtgctgaaccaggaagagatg
gagaaagtaagagttgaaaatgctacagttatggataaggcccgggctttgctggactgt
gtcattcggaaagggccccaggcatgccagatttgcatcaaccacatttgtgaagatgac
tgtcaccttgcaggactgctggggctctcctcaggtccacaatctgaaaaccattttaat
gcacaagattctctggaagcattttcttccttttcagctccacagactacgcaggacaac
caagttgtgttcacgttctcaggtccaagtctcaagctttgcccgctagagacagcccaa
aggatatggaaagaaaagtcagaagagatttatccaataaaaatgcaaagttcaggccgc
acccgtcttgccctcattatctgcaacacagagtttgacagtctccccagaaggactgga
gctgatgttgatatcagagatatgaagatgctgctgataggtctgggatacagtgtagat
gtgaaagaaaacctcaatgctttggacatggctacagagctgaaggcctttgctgatcgc
ccagagcactggacttctgacagtactttcctagtgttcatgtctcatggtactagagat
ggtatttgtgggaagaattactctgagcaatactcagatatactgaatgtcaacaccatc
tttgagatgttaaacaccaagaactgtcagagtttgaaagacaaacccaaggtgatcatc
atccaagcctgtcgtggtgaaaaccaaggaatagtgtggctaaaggattcaataggagat
tctggaaacacatctttactgaatccagatgattttgagtatgatgctagtaggatagcc
cacatagagaaggattttattgctttctgctcttcaactccagataatgtttcttggcga
catcccaaacagggttcacttttcattatgagactcatcaaaactatgcaggaatatgcc
tggtcttgtgatgtggaggaaatcttccgaaaggttcgattttcatttgaactgccagaa
ggtaggacacagatgcctaccactgaaagggtgacattgacaagacgtttctatctcttc
ccaggacattaa

DBGET integrated database retrieval system