KEGG   Oryctolagus cuniculus (rabbit): 100101592
Entry
100101592         CDS       T03373                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04370  VEGF signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05215  Prostate cancer
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100101592 (CASP9)
   04151 PI3K-Akt signaling pathway
    100101592 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100101592 (CASP9)
   04215 Apoptosis - multiple species
    100101592 (CASP9)
   04115 p53 signaling pathway
    100101592 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100101592 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100101592 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100101592 (CASP9)
   05212 Pancreatic cancer
    100101592 (CASP9)
   05215 Prostate cancer
    100101592 (CASP9)
   05213 Endometrial cancer
    100101592 (CASP9)
   05222 Small cell lung cancer
    100101592 (CASP9)
   05223 Non-small cell lung cancer
    100101592 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100101592 (CASP9)
   05012 Parkinson disease
    100101592 (CASP9)
   05014 Amyotrophic lateral sclerosis
    100101592 (CASP9)
   05016 Huntington disease
    100101592 (CASP9)
   05020 Prion disease
    100101592 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    100101592 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100101592 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100101592 (CASP9)
   05152 Tuberculosis
    100101592 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100101592 (CASP9)
   05162 Measles
    100101592 (CASP9)
   05164 Influenza A
    100101592 (CASP9)
   05161 Hepatitis B
    100101592 (CASP9)
   05160 Hepatitis C
    100101592 (CASP9)
   05168 Herpes simplex virus 1 infection
    100101592 (CASP9)
   05163 Human cytomegalovirus infection
    100101592 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100101592 (CASP9)
   05169 Epstein-Barr virus infection
    100101592 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100101592 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100101592 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100101592 (CASP9)
   01002 Peptidases and inhibitors [BR:ocu01002]
    100101592 (CASP9)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100101592 (CASP9)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100101592 (CASP9)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C14: caspase family
   100101592 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 100101592
NCBI-ProteinID: XP_008247984
Ensembl: ENSOCUG00000016047
LinkDB
Position
Un
AA seq 441 aa
MDEADRQLLRRARLRLVKELQVAELWDALVSCELFTADMIEAIQHAGTRRDQARQLVIDL
ETRGRQALPLFISCLEDTGQHTLASFLRASRQERDPEAIRPLPLTPFVLGPVGLQPEKPT
AVTSQAALGNLSPVVLGPEELWPAKLRPEVLRPVDSSSGGFRDVCAQDGVRGNVDLAYVL
DAEPCGHCLIINNVNFSSTSGLSARNGSNIDCAKLQHRFCSLHFTVEVKPDLTAKEMLLA
LAELAQRDHSALDCCVVVILSHGCQASHLQFPGAVYGTDGYPVPVERVVNIFNGTSCPSL
GGKPKLFFIQACGGEQKDHGFEVASACPEDRTSGHNLEPDATPFQGGPRTSDDQVDAVSS
LPTPSDILVSYSTFPGFVSWRDPKSGSWYVETLDHILGRWAPTEDLQSLLLRVANAVSER
GIYKQIPGCFNFLRKKLFFKT
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggacgaggccgaccgccagctcctgcggcgcgcccggttgcggctggtgaaagagctg
caggtggccgagctgtgggacgcgctggtcagctgcgagctcttcacggccgacatgatc
gaggccatccagcacgcggggactcgccgggatcaggccaggcagctggtcatagatctg
gagacccgagggaggcaggcccttcctttgttcatctcctgcctggaggacactggccag
cacacactggcttctttcctgcgagccagtaggcaggaacgggaccccgaggccatcaga
cctctgccgctgacaccctttgtgctgggaccagtgggcctccaaccagagaagccgaca
gcggtgacttcgcaggcggccctgggaaacctctccccggtggtgctggggcctgaggag
ctatggccagccaagctcaggccagaggttctcaggccggtggactccagttctggagga
ttccgtgatgtctgtgctcaggatggtgtgagaggaaacgtggatttggcgtacgtcctg
gacgcagagccctgtggccactgcctcatcatcaacaacgtgaacttcagcagcacctcg
gggctcagcgcccgcaacggctccaacatcgactgcgcgaaactgcagcaccgcttctgc
tcgctgcacttcaccgtggaggtgaagcctgacctgaccgccaaggaaatgctcctggcc
ttggcggagctggcacagcgggaccacagcgccctggactgctgcgtggttgtcatcctg
tctcacggctgccaggccagccacctccagttccctggggccgtctatggcacggacgga
taccccgtgcccgttgagagagtcgtgaacatcttcaacgggaccagctgccccagcctg
ggtgggaagcccaagctcttcttcatccaggcctgcggaggggagcagaaggaccacggg
tttgaggtggcctccgcttgtcccgaagacaggacctctgggcacaacctggagccggat
gccaccccattccagggaggcccgaggacctccgatgaccaggtggatgctgtgtctagc
ttgcccacgcccagtgacatcctcgtgtcctactccaccttcccaggtttcgtctcctgg
agggatcccaagagcggctcgtggtacgtggagaccctggaccacatcctggggcggtgg
gctcccaccgaagacctacagtccctgctgctccgggtcgcgaatgctgtttccgagcga
gggatttacaaacagatccctggctgttttaatttcctccggaaaaagcttttctttaaa
acttag

DBGET integrated database retrieval system