KEGG   Oryctolagus cuniculus (rabbit): 100126565
Entry
100126565         CDS       T03373                                 

Gene name
MET
Definition
(RefSeq) MET proto-oncogene, receptor tyrosine kinase
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu05100  Bacterial invasion of epithelial cells
ocu05144  Malaria
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05211  Renal cell carcinoma
ocu05218  Melanoma
ocu05223  Non-small cell lung cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100126565 (MET)
   04014 Ras signaling pathway
    100126565 (MET)
   04015 Rap1 signaling pathway
    100126565 (MET)
   04020 Calcium signaling pathway
    100126565 (MET)
   04151 PI3K-Akt signaling pathway
    100126565 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100126565 (MET)
   04520 Adherens junction
    100126565 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100126565 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100126565 (MET)
   05202 Transcriptional misregulation in cancer
    100126565 (MET)
   05206 MicroRNAs in cancer
    100126565 (MET)
   05205 Proteoglycans in cancer
    100126565 (MET)
   05230 Central carbon metabolism in cancer
    100126565 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100126565 (MET)
   05226 Gastric cancer
    100126565 (MET)
   05218 Melanoma
    100126565 (MET)
   05211 Renal cell carcinoma
    100126565 (MET)
   05223 Non-small cell lung cancer
    100126565 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100126565 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    100126565 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100126565 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100126565 (MET)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100126565 (MET)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  MET family
   100126565 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100126565
NCBI-ProteinID: NP_001164511
Ensembl: ENSOCUG00000013060
UniProt: Q09YN5
LinkDB
Position
7
AA seq 1382 aa
MKAPAVLAPGILVLLFTLVPRSHGECKEALVKSEMNVNMKYQLPNFTAETPIQNVLLHQH
HVYLGAINHIYVLNDKDLQKVAEYTTGPVLEHPDCLPCQDCSSKANSSGAVWKDNINLAL
LVDKYYDDQLISCGSVNRGTCQRHVLPPDNPADIQSGVYCMFSPQADEEPGQCPDCVVSP
LGAKVLLSKKQRFIYFFVGNTINSSYLPDHSLHSISVRRLKETQDGFKFLTDQSYIDVLP
EFRDSYPIKYVHAFESNHFIYFLTVQKETLDAQTFHTRIIRFCSKDSGLHSYMEMPLECI
LTEKRRKRATREEVFNILQAAYVSKPGAHLARQIGATPNDDILYGVFAQSKPDSAEPMNR
SAVCAFPIKYINEFFNKIVNKNNVKCLQHFYGPNHEHCFNRTLLRNSSDCEARSDEYRTE
LTTALQRVDLFMGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVISRTILNVPHVNF
RLDSHPVSPEVVVEHPLNQNGYTLVVTGNKITKIPLNGLGCGHFQSCSQCLSAPPFVQCG
WCHDKCVPSEECPSGTWTQEICLPAIYKVFPASAPLEGGTTLTICGWDFGFRKNNKFDLK
KTKVLLGNESCALNLSESTTNTLKCTVGATTHEHFNMSITVSNSRGRTQYSTFSYVAPVI
TSISPSYGPKAGGTLLTLTGKYLDSGNSRHISIGGKTCTLKSMSNSILECYTPAQTISTE
FPVKLEIDLASRETSSFSYREDPIVDEFYPTKSFISGGSTITGVGKNLDSVSVPRMVISV
HEAGSNFTVACQHRSNSEIICCTTPSLQQLNLHLPLKTKAFFMLDGILSKHFDLTYVHNP
VFKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHSDSEAVLCTVPND
LLKLNSELNIEWKQAVSSTVLGKVIVQPDQNFMGLIVGGVSISIILLLLLGLFLWLKKKK
RIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNG
SCRQVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVH
FSEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDALYEVMLKC
WHPKAEMRPSFSELVSRISTIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNVDGTV
DT
NT seq 4149 nt   +upstreamnt  +downstreamnt
atgaaggcgcccgctgtgcttgcacctggcatccttgtgctcctgtttaccttggtgccg
aggagccatggggagtgtaaagaggcactggtgaagtccgagatgaatgtgaacatgaag
tatcagcttcccaacttcaccgctgaaacgcccatccagaacgtccttctgcaccagcat
cacgtctacctcggtgccatcaaccacatctacgttttaaatgacaaagaccttcagaag
gttgctgaatacacgaccgggcccgtgctggaacacccggactgtttgccgtgtcaggac
tgcagcagcaaagccaattcctcaggtgctgtttggaaagataacatcaacctggctctg
cttgttgacaagtactatgatgaccaactcattagctgtggcagcgtcaacagagggacc
tgccagcgacacgtcctcccacctgataatcctgctgacatacagtcgggggtttactgt
atgttctccccacaggcagatgaagagcctggccagtgtcctgactgcgtggtgagcccc
ctgggagccaaagttctcctatccaaaaagcagcgcttcatctacttctttgtgggcaat
accataaattcttcttaccttccagatcactcattgcattcgatatcagtgagaaggctg
aaggaaacacaggatggttttaagtttctgacggatcagtcctatattgatgtcctaccc
gagttccgagattcctaccccattaagtatgtccacgcttttgaaagcaaccattttatt
tacttcctgacggtccaaaaggaaactctagatgctcagactttccacacaagaatcatc
aggttctgttccaaggactccggcttgcattcctacatggaaatgcctctggagtgtatt
ctcacggagaagaggaggaagagagccaccagggaggaagtgtttaatatccttcaggct
gcatatgtcagtaagcctggggcccatcttgctaggcagattggagccaccccgaatgat
gacattctctatggggtgttcgcccagagcaaaccagattccgctgaacccatgaatcga
tctgccgtctgtgcattccctatcaaatatatcaatgaattcttcaacaagatcgtcaac
aaaaacaacgtgaaatgtctccagcatttttatggacccaatcatgagcactgcttcaat
aggacacttttgaggaattcgtcagactgtgaggcacgcagcgatgaataccgtacagag
ctgaccaccgcgctgcagcgtgtggacttattcatgggccagttcaaccaagtcctctta
acatccatctccaccttcattaaaggcgacctcaccattgctaacctcgggacctcagag
ggtcgtttcatgcaggttgtgatttctcgaacgatactgaacgtccctcatgtgaatttt
cgcctggattcccaccctgtgtctccagaagtagttgtggagcacccgttaaaccagaat
ggctacacactggtggtcacaggaaacaagattaccaaaatcccattgaatgggttgggc
tgtggacatttccagtcctgcagtcagtgtctctccgcccctccctttgtgcaatgtggc
tggtgccatgacaagtgtgtgccgtcagaggaatgccccagcgggacgtggactcaagag
atctgtctgcctgcaatctacaaggttttcccagccagtgcaccccttgagggagggacc
acactgaccatctgtggctgggactttgggttcaggaagaataataaatttgatttaaag
aaaaccaaagtcctccttggaaatgaaagctgtgccttgaacttaagtgagagcacgaca
aatacgttgaaatgcacagttggtgctacaacgcatgagcatttcaatatgtccataact
gtttcaaacagtcgagggagaacacagtatagtacattttcttatgtggctcctgtaata
acaagtatttctccaagttatggccccaaggctggtggcactttactcactttaactgga
aaatacctggacagtggaaattccagacacatttcaattggtggaaaaacatgtacttta
aaaagcatgtcaaacagtattcttgagtgttatactccagcccaaaccatttcaactgaa
tttcctgttaaattggaaatcgacttagccagccgagaaaccagcagcttcagttaccgg
gaagaccccattgtggatgaattttatccaaccaaatcttttattagtggtggaagcacc
ataacaggtgttggaaaaaacctggattcagttagtgtcccaaggatggtaataagtgtg
cacgaagcaggaagtaacttcacagtggcatgtcagcatcggtccaactcagagatcatc
tgctgcaccactccttcactgcaacagctgaatctgcacctccccctgaaaaccaaagcc
tttttcatgttggatgggatcctttccaaacactttgatctcacttatgtacataatcct
gtgtttaagccttttgaaaagccagtgatgatctcaatgggcaatgaaaatgtactggaa
attaagggaaatgatattgaccctgaagcagttaaaggtgaagtgttgaaagttggaaat
aagagctgtgagaacatacactcagattctgaagccgtcttatgcacggtccccaatgac
ctgctgaaattgaacagtgaactaaatatagagtggaagcaagcagtttcttcaactgtc
cttggaaaagtaatagttcaaccagatcagaattttatgggattgattgttggtggtgtc
tccatatcaataatacttttattattacttggactgtttttgtggctaaaaaagaaaaag
cgcattaaagatctgggcagtgaattagttcgctatgatgcaagagttcacactcctcat
ttggataggcttgtaagtgcccgaagtgtgagcccaactacagaaatggtttcaaatgaa
tctgtagactacagagctacttttccagaagaccagtttcctaactcatctcagaatgga
tcatgcagacaagtgcagtatcctctgacggacctgtctcccatcctaactagtggagac
tctgatatatccagtccattactgcaaaatactgtccacattgacctcagtgctttaaat
ccagagctggtccaagcagtccagcacgtagtgattgggccaagtagcctgattgtgcat
ttcagtgaagtcataggaagagggcattttggttgtgtatatcatgggactttgttggac
aatgatggcaagaaaattcactgtgctgtgaaatctttgaatagaatcactgacatagga
gaagtttcccagttcctgactgaggggatcatcatgaaagacttcagtcatcccaatgtc
ctgtcactcttgggaatctgccttcgaagtgaagggtctccactggtggtcctaccgtac
atgaaacatggagatctcagaaatttcattcgaaatgagacacataacccgactgtaaaa
gatcttattggctttggtcttcaagtagcaaaaggcatgaaataccttgcaagcaaaaag
tttgtccacagagacttggctgcaagaaactgtatgttggatgaaaaattcactgtcaaa
gttgctgattttggtcttgcccgagatatgtatgataaagaatactatagtgtacacaac
aaaacaggtgcaaaactgccagtgaagtggatggctttagaaagtctgcaaactcagaag
tttacaaccaaatctgatgtgtggtccttcggcgtgctcctgtgggagctgatgacaaga
ggagccccaccttaccctgatgtgaacacctttgacataaccgtgtacctgctgcaaggc
aggagactcctgcaacccgaatactgcccagatgccttgtacgaagtgatgctaaagtgc
tggcacccgaaagccgaaatgcgcccgtccttctcagaactggtctccaggatatccacg
atcttctctactttcattggggagcactatgtccacgtgaatgcgacttacgtgaacgtg
aaatgtgtggctccctatccttctctgctgtcatcgcaggataacgtggatggcacagtg
gacacgtga

DBGET integrated database retrieval system