KEGG   Oryctolagus cuniculus (rabbit): 100134865
Entry
100134865         CDS       T03373                                 

Gene name
CDK2
Definition
(RefSeq) cyclin dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04115  p53 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04218  Cellular senescence
ocu04914  Progesterone-mediated oocyte maturation
ocu04934  Cushing syndrome
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05215  Prostate cancer
ocu05222  Small cell lung cancer
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100134865 (CDK2)
   04151 PI3K-Akt signaling pathway
    100134865 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100134865 (CDK2)
   04114 Oocyte meiosis
    100134865 (CDK2)
   04115 p53 signaling pathway
    100134865 (CDK2)
   04218 Cellular senescence
    100134865 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100134865 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100134865 (CDK2)
   05203 Viral carcinogenesis
    100134865 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100134865 (CDK2)
   05215 Prostate cancer
    100134865 (CDK2)
   05222 Small cell lung cancer
    100134865 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100134865 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100134865 (CDK2)
   05161 Hepatitis B
    100134865 (CDK2)
   05160 Hepatitis C
    100134865 (CDK2)
   05162 Measles
    100134865 (CDK2)
   05169 Epstein-Barr virus infection
    100134865 (CDK2)
   05165 Human papillomavirus infection
    100134865 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100134865 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100134865 (CDK2)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100134865 (CDK2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100134865 (CDK2)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100134865 (CDK2)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100134865 (CDK2)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100134865 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 100134865
NCBI-ProteinID: XP_002711107
Ensembl: ENSOCUG00000000998
UniProt: A0A5F9C2I2
LinkDB
Position
4
AA seq 298 aa
MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaggtggaaaagatcggagagggcacgtacggagtggtgtacaaa
gccaaaaacaagctgacgggagaagtggtggcgctcaagaaaatccgcctggacactgag
actgaaggtgtacccagcactgccatccgggagatctctctgcttaaggagcttaaccac
cccaatattgtcaagctgctggatgtcatccacacggaaaacaaactttacctcgttttt
gaattcctgcaccaagatctcaagaaattcatggatgcctctgctctcactggcattcct
cttcccctcatcaagagctatctgttccagctgctccaaggcctagcgttctgccattct
catcgggtcctgcaccgagatctaaaacctcagaatctacttatcaatgcagagggctcc
atcaagttagccgactttggactagccagagcctttggagtgcctgttcgtacttacacc
cacgaggtggtgaccctgtggtaccgagcccctgagatcctcctgggctgcaaatactac
tccacagccgtggacatctggagcctgggctgcatctttgccgagatggtgacccgccgg
gccctgttccctggtgattctgagattgaccagctcttccggatcttccggactctgggg
accccagatgaggtggtttggccaggagttacttcaatgcccgattacaagccgagtttc
cccaagtgggcccggcaggattttagcaaagtcgtgcctcccctggatgaagatggacgg
agcttgttatcgcaaatgttgcactatgaccccaacaagcggatttcggcaaaggcagct
ctggctcaccccttcttccaggatgtgaccaagccagtaccccatctccgactctaa

DBGET integrated database retrieval system