KEGG   Oryctolagus cuniculus (rabbit): 100134866
Entry
100134866         CDS       T03373                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin A2
  KO
K06627  cyclin-A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04152  AMPK signaling pathway
ocu04218  Cellular senescence
ocu04914  Progesterone-mediated oocyte maturation
ocu05161  Hepatitis B
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05203  Viral carcinogenesis
ocu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100134866 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100134866 (CCNA2)
   04218 Cellular senescence
    100134866 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100134866 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100134866 (CCNA2)
   05202 Transcriptional misregulation in cancer
    100134866 (CCNA2)
   05203 Viral carcinogenesis
    100134866 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100134866 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100134866 (CCNA2)
   05161 Hepatitis B
    100134866 (CCNA2)
   05169 Epstein-Barr virus infection
    100134866 (CCNA2)
   05165 Human papillomavirus infection
    100134866 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100134866 (CCNA2)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100134866 (CCNA2)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100134866 (CCNA2)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100134866 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N2 Cyclin_N Cyclin_C Sororin
Other DBs
NCBI-GeneID: 100134866
NCBI-ProteinID: NP_001244293
Ensembl: ENSOCUG00000028042
UniProt: H8YL89
LinkDB
Position
15
AA seq 424 aa
MLGHNVPKPAAREAGSALLEDQENINPEKAVHAQQPRAQAALAVLKAGNSRGPVPQQRPT
TRRVAPLKDLPINDEQVSVPPWKANSKQPAFTIHVDEAEEEPPKRPTESKKDKPEDVLAF
NSAITLPGQRKPLVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHEDIHTYLRE
MEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSV
LRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAA
PTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVT
GQSWPESLVRKTGYTLETLNPCLVDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPE
TLNV
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgttgggccacaacgtgccgaagcccgcggcccgcgaggcgggctcggcgctcctagag
gaccaggagaacatcaaccccgagaaggcggtgcacgcccagcagccgcgggcccaggct
gctctggcagtactgaaggctgggaactcccggggtccagttccacaacagaggcccacg
acgcgacgggttgcacctcttaaggatcttcctataaatgatgagcaggtctctgttcct
ccttggaaagcaaacagtaaacagcctgcattcaccattcatgtggatgaagcagaagaa
gagcctcccaagaggcccacggaatctaaaaaagacaagcctgaagatgtcctggctttt
aattcagccatcactttacctggacaaagaaaaccactggtacctcttgattatccaatg
gatggtagtttcgagtcaccacatactatggacatgtcaattgtattagaagatgaaaag
ccagtgagtgttaatgaagtcccagactaccatgaggatattcacacatatcttagggaa
atggaggttaaatgtaaacctaaagtgggttacatgaagaaacagcctgacatcactaac
agtatgagggctatcctcgtggactggttagttgaagtaggagaggaatataaactacag
aatgagactctgcatttggcggtgaactacatcgataggtttctttcttcaatgtctgtg
ttgagaggaaagcttcagcttgtgggcactgctgctatgctgctagcctcaaaatttgaa
gaaatatacccaccagaagtagcagagtttgtatacattacagatgatacctatacaaag
aaacaagttctgagaatggagcatctagttttgaaagtccttgcttttgacttagctgca
ccaacggtaaatcagtttcttacccaatactttctacatcagcagcctgcaaactgcaaa
gtcgaaagtttagcaatgtttttgggagaattaagtttgatagatgctgacccataccta
aagtatctgccatcagttattgctggagcagcatttcatttagcactctacacagtcacg
ggacaaagctggcctgaatcattagtacgaaagactggatacactctggagactcttaac
ccttgtctcgtggaccttcaccagacctacctcaaagcaccacagcatgcacaacaatca
ataagagaaaagtacaaaaattcaaagtatcatggtgtttccctcctcaacccaccagag
acactaaatgtctaa

KEGG   Oryctolagus cuniculus (rabbit): 100358389
Entry
100358389         CDS       T03373                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin A1
  KO
K06627  cyclin-A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04152  AMPK signaling pathway
ocu04218  Cellular senescence
ocu04914  Progesterone-mediated oocyte maturation
ocu05161  Hepatitis B
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05203  Viral carcinogenesis
ocu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100358389 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100358389 (CCNA1)
   04218 Cellular senescence
    100358389 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100358389 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358389 (CCNA1)
   05202 Transcriptional misregulation in cancer
    100358389 (CCNA1)
   05203 Viral carcinogenesis
    100358389 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100358389 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100358389 (CCNA1)
   05161 Hepatitis B
    100358389 (CCNA1)
   05169 Epstein-Barr virus infection
    100358389 (CCNA1)
   05165 Human papillomavirus infection
    100358389 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100358389 (CCNA1)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100358389 (CCNA1)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100358389 (CCNA1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100358389 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 100358389
NCBI-ProteinID: XP_008271778
Ensembl: ENSOCUG00000015876
UniProt: G1TAE6
LinkDB
Position
Un
AA seq 423 aa
MHRSSSSSTSGVVVAPAARGPDTCQMLTRAQLGQDPPQRTVLGLLTENGQYRRTCGQGLM
ATKCFPGSENVVPPAGKKLPPECGDQEQGKQGLDIYMEESEQGQGDGCPQKEGMAFEDVY
EVDTSTLKSDLHFLLDFSTVSPMLVDSSLHFQSEDAADLGTDVINVTEYAEEIHQYLREA
EIRHRPKAHYMRKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVL
RGKLQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVP
TTNQFLLQYMRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTVNRH
FWPETLAAFTGYSLNEIVPCLSELHKACLDIPHRPQQAIREKYKASKYLHVSLMEPPAVL
PLQ
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgcatcgcagcagcagtagctccacaagcggggtggtcgtggctcccgcggcccgaggt
cctgacacttgtcagatgctcaccagagcccagctgggccaggacccccctcaaagaaca
gtgttggggctgctgactgagaatgggcagtacaggaggacctgtggccaggggctcatg
gcaaccaagtgttttcctggatcagaaaatgtcgttcctccagctggaaagaaattgccg
cctgagtgtggagaccaagagcaaggcaagcaaggattggatatctacatggaggagtct
gagcaggggcagggagatggctgcccccagaaggaggggatggcattcgaggacgtgtat
gaagttgacaccagcacactcaagtcggaccttcatttcctgctggatttcagcacagtg
tcccccatgctggtagattcatctctccatttccaatctgaagatgcggcagatctgggc
acagatgtgataaatgtgactgagtatgctgaagaaattcatcagtaccttagagaagcc
gaaataagacacaggcccaaagcacactacatgaggaagcagccagacatcacagaaggc
atgcgtacgattctggtggactggcttgtggaggttggcgaggagtataaacttcgagca
gagaccctgtatctggctgtcaacttcctggacaggtttctgtcctgcatgtctgtcctc
agggggaaattacagctcgtgggaacagcagctattctcctggcctcgaaatacgaagag
atatatccgcccgaagtagacgagtttgtctatattaccgatgacacgtacacaaaacga
caactgctaagaatggaacacctactcctgaaagtcctggctttcgatctgacagtgcca
accaccaaccagtttctcctgcaatacatgaggcgtcagggagtgtgcatcagaactgag
aacctggccaagtatgtggcagaactgagtctactcgaagctgacccattcttgaaatat
cttccttcactgatagctgcagcagcttactgcctggcaaactatactgtgaacaggcac
ttctggccagaaacccttgctgcgtttacaggctattcattaaatgaaattgtgccttgt
ctgagtgagctacataaagcgtgccttgatataccccatcgacctcagcaagcaattaga
gagaagtataaggcttcaaagtatttgcatgtgtctctcatggaaccacctgcagttctt
cctctacaataa

DBGET integrated database retrieval system