KEGG   Oryctolagus cuniculus (rabbit): 100144338
Entry
100144338         CDS       T03373                                 

Gene name
IL18
Definition
(RefSeq) interleukin 18
  KO
K05482  interleukin 18
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04621  NOD-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100144338 (IL18)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100144338 (IL18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100144338 (IL18)
   04623 Cytosolic DNA-sensing pathway
    100144338 (IL18)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100144338 (IL18)
   05321 Inflammatory bowel disease
    100144338 (IL18)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100144338 (IL18)
   05135 Yersinia infection
    100144338 (IL18)
   05134 Legionellosis
    100144338 (IL18)
   05152 Tuberculosis
    100144338 (IL18)
  09172 Infectious disease: viral
   05164 Influenza A
    100144338 (IL18)
  09174 Infectious disease: parasitic
   05144 Malaria
    100144338 (IL18)
   05143 African trypanosomiasis
    100144338 (IL18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100144338 (IL18)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100144338 (IL18)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 100144338
NCBI-ProteinID: NP_001116412
UniProt: B1A3U4
LinkDB
Position
1
AA seq 192 aa
MAAEPEEACINFVGMKFIDNTLYFITENDENLESDYFGKLEPKISIIRNLNDQVLFMDQG
QQPVFEDMPDSDCIENAPQTIFIIYMYKDSNTRGMAVSLSVKCKKIFTLSCENKIISFKE
LTPPNDINDTKSDIIFFQKHLAGQKDKMQFESSLYDGYFLACGKEKDLFKLVLKRKDDKN
DKSVIFSVQNKN
NT seq 579 nt   +upstreamnt  +downstreamnt
atggctgctgaaccagaagaggcttgcatcaactttgtgggaatgaaatttattgacaac
acactttactttataactgaaaacgatgagaacctggaatcagattactttggcaagctt
gaaccgaaaatctccatcatacgaaacctgaatgaccaagttctcttcatggaccaagga
cagcaacctgtgtttgaggatatgcccgattctgactgtatagaaaatgcaccccagacc
atttttataatatatatgtataaagacagcaatactagaggcatggctgtaagcctctct
gtgaagtgtaagaaaatttttacactctcctgtgagaacaaaattatttcctttaaggaa
ctcactcctcctaatgacatcaacgatacaaaaagtgacatcatattctttcagaaacat
ctcgcaggacagaaagataagatgcagtttgagtcttcattgtatgacggatactttcta
gcttgtggaaaggagaaagatcttttcaaacttgttttgaaacgtaaagatgacaaaaac
gataaatctgtaattttcagtgtccaaaacaagaattag

DBGET integrated database retrieval system